CAZyme Information: THC88929.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC88929.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	SOSA01000739|CGC1	40318.76	5.8143

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000739:11943-13282(+)

Full Sequence      

MTWSISQKRFARLVLYVIGVATIIFIVLPFPAFRNPVRVASSNEGHYLRAIRNVTLGVEK
IFVINLPTRPDKRDSIILGSSISNFHVDWIDGVTPDQISALSYPYVSARIIVDKGLGSAI
IMEDDADWDVTVKTQLQSLAIAVRALQGTSPMSTASPYGDDWDILWLGHCGIECQTNSSF
FLTPRDPTILPPHHFLPYWREPPPIERPDHARLTCTASDGACSIVYAVSYRGARKILSAL
SVNPTGIAEQIDIGAQFDVSLGRMCGNGYLRCFATYPSLTGGYITSSDIHDSGESKERSR
ERPSSSGVMYSTLLNINRILHGEPTVHSTWDDAATPDIRPDSIAVLGGTLQVPEENGLRE
IPFDSPS

Enzyme Prediction     

No EC number prediction in THC88929.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.04e-11	60	129	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	8.96e-04	60	240	3	189	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25421.1|GT25	1.36e-154	1	352	1	382
CAK40570.1|GT25	1.85e-148	6	366	6	386
BCS04381.1|GT25	1.85e-148	6	356	6	376
BCS15969.1|GT25	1.85e-148	6	356	6	376
CAP99059.1|GT25	9.81e-139	1	354	1	382

PDB Hits     

THC88929.1 has no PDB hit.

Swiss-Prot Hits     

THC88929.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999916	0.000121

TMHMM  Annotations     

Start	End
13	32