CAZyme Information: THC87999.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC87999.1
• CAZy Family: AA3
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A4S3IZY9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		51291.13	4.9947

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000966:4275-5957(+)

Full Sequence      

MVDVFSNMRFLSGRQLWGAALLLLQARPVLSDLNVVATSDDSLKQAAKAIVAPMMKFYQQ
NQTEGIPGKLTDTWYVAGSMFMTLIQYWKASGDDSQNKIVSHDLMFQAGENYDFFHHNVS
QWLGNDDQMFWGLASITASECGFPDVEGKPSWTSLARAVFNMQASRWDTATCNGGMRWQI
WPYQAGYTMKNAISNGGLFELAARLARFTKNETYSEWADKIWDWSATTPLLQTKTWYIAD
STNNEANCKDAGNDQWTYNYGTYLAGAAFMYNHTNGDDKWLKRVNGLLDSTMGKFFPKQY
GGNVMSEVACEPIMSCDRNQLCFKGYLAMWMAHTAILVPSTAERIIPKLQGSAVAIGKQC
SGESENLCGETWGKPEWDGMQGLEVQMAALGGITSNLMLSSKARDPNTIDTNPNAKETLI
PTTGDSDPTKLSPIETADRAGAWILTIMMIATVTGAVGWLVKS

Enzyme Prediction     

No EC number prediction in THC87999.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	40	406	8.1e-98	0.952513966480447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.87e-180	42	390	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48345.1|GH76	2.76e-261	8	463	1	457
QRD92720.1|GH76	2.76e-261	8	463	1	457
QMW36289.1|GH76	2.76e-261	8	463	1	457
UDD65548.1|GH76	2.76e-261	8	463	1	457
BAE66452.1|GH76	3.92e-261	8	463	1	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	7.20e-82	41	411	34	415	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6I3|YHG7_SCHPO	2.29e-89	38	446	25	426	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|P36091|DCW1_YEAST	4.85e-87	41	461	30	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	6.19e-86	19	415	10	406	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	1.94e-85	42	461	28	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	7.10e-84	39	461	25	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000663	0.999303	CS pos: 31-32. Pr: 0.9654

TMHMM  Annotations     

Start	End
439	461