CAZyme Information: THC87997.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC87997.1
• CAZy Family: AA3
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A4S3J224]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		38082.35	6.0909

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01000966:1808-3141(+)

Full Sequence      

MAIKTNIPFTADYVIIGGGTAGLTLASRLSENSTESIVVLEAGSNLLEDPRAALGNRVIK
EPQGKLLGGPSGISSQAFVAPSQSGIDAWSKLGPLKVSFPAAIQDPLCRAWVDTFKATGH
GITADPFSGKSTGGYSNLSAVDSETKTRSYAASAYGRSPMERPNVHIVTEALVQRILFKG
LKESSVTAGGIEAVIQGEIHTITANKEVIVCAGALNTPKLLELSGIGNKEILHQYNIHVV
VNSPSVGENLQDHLMSGISFEVVNGVVTGDPLLRQEPEAVQAAMQLYMEHKTGPMTIRGV
QSSSYMPLVYFQGQNSSTSIKEYLDGFFLRSSDRDHAIREIIGQPDAPTCSTILCILI

Enzyme Prediction     

No EC number prediction in THC87997.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	93	353	1.4e-62	0.4295774647887324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.74e-57	10	254	5	300	choline dehydrogenase; Validated
225186	BetA	1.27e-42	4	302	1	349	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	2.23e-26	11	254	1	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.54e-18	10	258	55	332	Protein HOTHEAD
223652	LhgO	0.005	10	41	3	35	L-2-hydroxyglutarate oxidase LhgO [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02826.1|AA3_2	3.62e-133	1	354	1	420
BCS14479.1|AA3_2	3.62e-133	1	354	1	420
QDL52568.1|AA3_2	1.20e-131	2	354	3	421
QSS68114.1|AA3_2	2.47e-131	5	354	4	420
CAK46356.1|AA3_2	9.31e-131	1	354	1	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	9.64e-34	10	269	5	331	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	3.52e-32	6	297	1	354	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	4.50e-23	12	296	3	353	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.52e-23	12	296	4	354	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	1.25e-21	12	295	8	348	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	5.18e-46	12	296	15	370	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	4.65e-44	12	264	48	372	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.65e-44	12	264	48	372	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.38e-39	8	296	13	364	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.38e-39	8	296	13	364	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000004

TMHMM  Annotations     

There is no transmembrane helices in THC87997.1.