CAZyme Information: THC87105.1

Basic Information

• Species: Aspergillus tanneri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tanneri
• CAZyme ID: THC87105.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647		70667.12	6.4527

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtanneriNIH1004	13590	N/A	33	13557

• Gene Location: location=SOSA01001487:858-2801(+)

Full Sequence      

MLIRRFFGLVAISTGLTTAVELSGYEYIVVGSGAGGGPLATRLALAGHKTLLIEAGNDQG
QNHNYSIPSYSARASEDEKLAWNFFVRHYADEERQARDYKTTYTTSDGDEYTGLDPPENS
TMKGTLYPRTGTLGGCTAHNALVTIYPHQSDFEYLVALTGDRSWSPENMRKYFTRLENNH
YLLFPGSRGHGTKGWLHTSTTPLGLVLQEPQLLSVILGGAFALGNRTNTVFNLATLLAAD
ANDGSVARDTQPGYYQVPIATQDGRRSGPRDFIIAVRDAKNRDGTKKYPLDVRTDCFVTK
VIFDKSVQPPRATGVEFLDGKYLYRASPLANPRTASPGTPGRATASREVIVSGGVYNSPQ
LLKLSGIGPAEELRKFGIKVISDLPGVGTNLQDHYEVAVQGHVPKNWGIADGCTWEDDEN
QDRCLGQWSNPTLLGGRGLYAAPGAASTMFYKSSVTTDNSYDAFVFGLPANFRGYFPQYS
QYLTDRHDWFTWAVLKGHPRNTAGSVTLRSADPLDMPDIVFNYFDTGSGDYNADLQAIYE
AVQLGREAFASQPVKVNEVLPGPHVQTKEAIQQYAKDTAWGHHASCTCPIGADGDLMAVL
DSKFRVRGVRGLRVVDASVYPRIPGTFTALSTYLVAEKAADDILSEL

Enzyme Prediction     

No EC number prediction in THC87105.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	645	5.5e-96	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.05e-80	25	644	6	532	choline dehydrogenase; Validated
225186	BetA	8.86e-73	25	646	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.82e-34	504	639	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.30e-20	298	626	243	559	Protein HOTHEAD
366272	GMC_oxred_N	1.03e-19	125	396	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33146.1|AA3	0.0	1	647	1	645
QRD84722.1|AA3	0.0	1	647	1	645
QMW45179.1|AA3	0.0	1	647	1	645
UDD58256.1|AA3	0.0	1	647	1	645
EAA61171.1|AA3	0.0	1	647	1	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	3.36e-45	25	640	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.60e-44	25	640	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.60e-44	25	640	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.60e-44	25	640	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.99e-44	25	640	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7FKL6|BETA_YERP3	1.64e-45	25	643	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	1.64e-45	25	643	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	3.07e-45	25	643	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	3.07e-45	25	643	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	3.07e-45	25	643	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.560459	0.439539

TMHMM  Annotations     

There is no transmembrane helices in THC87105.1.