CAZyme Information: TDH72338.1

Basic Information

• Species: Bremia lactucae
• Lineage: Oomycota; NA; ; Peronosporaceae; Bremia; Bremia lactucae
• CAZyme ID: TDH72338.1
• CAZy Family: GH81
• CAZyme Description: GH18 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A484ECK3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		40851.32	6.2993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BlactucaeSF5	1418	N/A	0	1418

• Gene Location: location=SHOA02000038:935975-937275(-)

Full Sequence      

MYTALGLVASTLTQEEQNRLNKCPCTSDFGSKSLCLPVDFSIEKPRKEVFAFSITTENKW
KNYDWDTVTTVAWNEDKKLLCHAHSKGVKVVVKHNFDDTSQLCNASARQEWIKATYEKNV
DNYADGVNIDTEKPMHGITSQFLALLMLELRQELKQHALTRHAQVTFGVPWAPRGVDGRF
YPWRELAAAADFLFVMSYDIRSQVYDEFLLGYDIPPSKLVLGVPWYGYRYPCLQGQLSAA
TIDDASWCQIQPAPFFGAPCSDAAGTQVNYGNVRRLMKSQGLIEQWDPTTLSPFVWYSSP
EGGRSQIWFDNLRSLEAKHALMRELGLRGVGMWHADALDYSLANDSQVMWRWLADAFRS

Enzyme Prediction     

EC	3.2.1.-:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	39	336	6e-32	0.8412162162162162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119354	GH18_chitobiase	1.55e-100	22	357	18	358	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
214753	Glyco_18	2.52e-27	104	337	88	333	Glyco_18 domain.
119353	GH18_CFLE_spore_hydrolase	1.31e-25	76	333	47	300	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
395573	Glyco_hydro_18	2.83e-24	49	337	27	306	Glycosyl hydrolases family 18.
226376	YaaH	1.71e-22	62	357	124	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27644.1|GH18	1.82e-166	10	359	454	839
CCA16750.1|GH18	5.10e-116	6	359	17	383
CCA27450.1|GH18	1.12e-115	20	359	3	354
AIG55971.1|GH18	5.79e-96	1	359	5	387
BAE00476.1|GH18	1.33e-70	23	341	38	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	2.07e-12	102	333	90	306	Chain A, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4WIW_A	3.75e-07	71	343	53	337	Chain A, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
5JH8_A	4.46e-07	98	350	79	307	Crystal structure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4MNJ_A	1.18e-06	67	346	59	345	Crystal Structure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]
6JM7_A	1.32e-06	108	340	102	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01460|DIAC_RAT	8.67e-71	23	350	26	360	Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
sp|Q8R242|DIAC_MOUSE	9.37e-70	23	350	25	359	Di-N-acetylchitobiase OS=Mus musculus OX=10090 GN=Ctbs PE=1 SV=2
sp|Q01459|DIAC_HUMAN	4.47e-69	23	341	41	362	Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
sp|Q8T293|DIAC2_DICDI	7.37e-56	23	357	26	374	Probable di-N-acetylchitobiase 2 OS=Dictyostelium discoideum OX=44689 GN=ctbs2 PE=3 SV=1
sp|Q7KWW8|DIAC1_DICDI	1.35e-47	17	358	17	371	Probable di-N-acetylchitobiase 1 OS=Dictyostelium discoideum OX=44689 GN=ctbs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000076

TMHMM  Annotations     

There is no transmembrane helices in TDH72338.1.