CAZyme Information: TDH66054.1

Basic Information

• Species: Bremia lactucae
• Lineage: Oomycota; NA; ; Peronosporaceae; Bremia; Bremia lactucae
• CAZyme ID: TDH66054.1
• CAZy Family: GH18
• CAZyme Description: Secreted protein [Source:UniProtKB/TrEMBL;Acc:A0A484DWU4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257		27778.03	7.1951

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BlactucaeSF5	1418	N/A	0	1418

• Gene Location: location=SHOA02000203:328715-329488(-)

Full Sequence      

MKINTFVATGAAILTSMRPVFGHNYLSHPAAYWTQGYASNGYGSTIDGTIFGEVDGSKYG
YGPEGTVNLIKEKLATEGGGSLPAFITKNQKLYSSQTDPYCGLTSYKESQRSKLPATALE
VTSFPHAGPCAFYCDDTLVVYEDNCQEKYPGIPALIPYDKAKCVNANRLTYYWIAVHDAQ
WQVYVDCVWLEGGSGIGSPPSATRGGSAGVKTLNNTSSSYVNKSPRASLPPMSEVGNESW
AEPTTSSPESKKCNRRQ

Enzyme Prediction     

No EC number prediction in TDH66054.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	11	249	6.2e-55	0.9224489795918367

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173806	Peptidases_S8_12	0.004	40	81	46	88	Peptidase S8 family domain, uncharacterized subfamily 12. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY56114.1|AA17	4.53e-97	1	206	1	206
ETK71888.1|AA17	1.57e-96	1	206	1	206
ETO60224.1|AA17	1.57e-96	1	206	1	206
ETN16020.1|AA17	1.73e-96	1	206	1	206
ETM31809.1|AA17	1.73e-96	1	206	1	206

PDB Hits     

TDH66054.1 has no PDB hit.

Swiss-Prot Hits     

TDH66054.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008138	0.991849	CS pos: 22-23. Pr: 0.9519

TMHMM  Annotations     

There is no transmembrane helices in TDH66054.1.