CAZyme Information: TDH64916.1

Basic Information

• Species: Bremia lactucae
• Lineage: Oomycota; NA; ; Peronosporaceae; Bremia; Bremia lactucae
• CAZyme ID: TDH64916.1
• CAZy Family: CE8
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A484DQK3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		77091.10	4.6828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BlactucaeSF5	1418	N/A	0	1418

• Gene Location: location=SHOA02000220:1375975-1378362(-)

Full Sequence      

MTMRNLLPVVLFATILHQVTAFDSIPDIGGILQSTLSNVTDKLIGTTKEASFQSFFDYNG
EYFAPFGTDEPSKELYVQNDSLKDIVPIINVAPEALKVAIPTNDWWTNLIHVTDSMDVSN
YAAWANPYAVKLPREAPYGLQTFYSFSYREFGDEVNGTVRYYNHSFHNDLTLSSKEFFSC
QPVYEIFEWDEGGAKVLLGGTVSMESRTSYTFHWDVEGSSCDTSGLLHFALHHQIESMGG
PVIDTTSYGAIILHSATRGQMVAQVTTTPMWSFVEPEADFEVDFYPPDRPSPWLVKKIDL
RNTLEEDILGNWSTWDVDSWYFNGKSFQKYASLCLMASDVSVVGRDTSLLSFCLDKLESL
IEPLLNNTLTPFLMYDTLYRGLISTSIFRANNIYEEFGNSIYNDHHYHYGYFVVASAILK
HLDPNWYRMPELEELIWTMLRDVANPSKKDPYYPCFRHFSWYLGHSYSHGVTSIDNGKDE
ESTSEDINFFYGMTLWGRVTGRKAVEDLGSLMLRLDAHAIRTYFLLKRDNTIHPPEIVRN
HVTGIFFDNLVLYNTWFLDEIYAIHGIQMIPVSPINRLARTSTFVAQEWNDILAKQPIIV
IENSNISWLSLLLVNGATVDPMESLRRLPNATMDDGLSLSWALYNAATRCRDGVKVNMAA
EITLTIDKNSVISIHTE

Enzyme Prediction     

No EC number prediction in TDH64916.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	199	644	2.8e-121	0.6752411575562701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.67e-123	300	643	10	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.11e-96	201	647	312	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.15e-08	198	286	234	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26131.1|GH81	2.37e-266	62	649	12	714
UIZ26137.1|GH81	2.94e-264	62	649	122	824
UIZ26602.1|GH81	2.94e-264	62	649	122	824
UIZ26438.1|GH81	6.18e-242	60	649	42	740
UIZ26440.1|GH81	6.18e-242	60	649	42	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	7.47e-71	199	649	269	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.11e-70	199	649	294	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.79e-68	199	649	269	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.51e-24	317	593	337	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.28e-17	403	538	439	576	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	3.34e-70	210	647	306	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.33e-69	184	643	643	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	8.45e-68	227	647	284	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	9.03e-65	196	647	450	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.20e-60	198	647	689	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000190	0.999797	CS pos: 21-22. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in TDH64916.1.