CAZyme Information: TDH64793.1

Basic Information

• Species: Bremia lactucae
• Lineage: Oomycota; NA; ; Peronosporaceae; Bremia; Bremia lactucae
• CAZyme ID: TDH64793.1
• CAZy Family: AA17
• CAZyme Description: EGF-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A484DQI2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		62658.02	5.0303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BlactucaeSF5	1418	N/A	0	1418

• Gene Location: location=SHOA02000220:1915582-1917559(-)

Full Sequence      

MSVLFAMLAIIALLQSTATAAPVDSVIIVRGNKLYNAKTGERFFMKGLTYEYAVSDEYYD
KYSKAVIEENLAGLEFNTLRLYNIHPGSSYKKFMDDMAKLGVYVMVSASPDNDEYYGKYR
YSTITKKLSCTGKVSTSGGAKTVDQTETCYPALLLEYGKKIIQNFAQYDNTLGVVVANEI
MQEDLTSASCVKAYVADLKKWMAVNGKKLRILPLAYAAADSSNDKVSNADDYHVIKVQGL
LCGDKMINGMMAESIDIYLINEYRWCPDSTFAEAFQRYINMAQGIPIVVAFGEYGCKLSK
STPRDWTMVPYLYEEPSKTKEFSAVWSGGLAYSYGEAKLSKDSLFPMFTGGSIDFLSTPS
SKPTTDYTNLKAMFAKYSGYTDDAAWADSSKCSWQPPLDTKTQSTNTLASEHGWIIDSCS
ESFLKLSSTDSWVCSSREGVVCTDDGGKCDVALSGTIGTTQEDICGSYVVISGGGNCKTT
SDCGGNGQCKESNGSMTCSCLSCYTGTDCSVKDISSCATLSSSSSAPQAIFFGIGVFLGL
MAVVFIALGVAAAKKRADTNKLAQQVKAGGTTAQSDAAAQ

Enzyme Prediction     

No EC number prediction in TDH64793.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	26	340	5.6e-73	0.8878205128205128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	6.98e-39	18	378	1	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
238011	EGF_CA	0.001	477	509	5	37	Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.
238010	EGF	0.008	477	506	2	31	Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26083.1|GH72	0.0	3	572	7	576
CCA22645.1|GH72	1.90e-224	27	571	332	866
CCA15473.1|GH72	2.03e-224	27	567	23	554
CCA14303.1|GH72	9.34e-181	24	472	57	505
AIG55862.1|GH72	6.77e-151	11	511	10	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.26e-23	27	376	36	342	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	2.99e-23	27	376	36	342	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	2.99e-23	27	376	36	342	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AJY5|PGA4_CANAL	2.34e-27	27	397	22	341	1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA4 PE=1 SV=1
sp|Q08193|GAS5_YEAST	3.83e-25	13	408	16	362	1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS5 PE=1 SV=1
sp|Q06135|GAS2_YEAST	6.49e-23	27	376	36	342	1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS2 PE=1 SV=1
sp|O13692|GAS5_SCHPO	1.21e-22	18	389	20	347	1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas5 PE=1 SV=1
sp|Q08271|GAS4_YEAST	2.20e-22	27	374	26	331	1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000192	0.999777	CS pos: 20-21. Pr: 0.9780

TMHMM  Annotations     

Start	End
529	551