CAZyme Information: SSD61776.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD61776.1
• CAZy Family: GT62
• CAZyme Description: probable Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		94783.37	6.1226

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000885:329-2899(-)

Full Sequence      

MSFPKKNTFDVEEILKQLTLQEKVELLSAVDFWHTSKIPRLGIDWQIRVSDGPNGIRGTR
FFDSVPSACFPNGTGLASSFNSDLLEKAGKLMAVEARHKNAHIILGPTTNIQRGPLGGRG
FESFSEDPYLSGIATASIVKGIQADGDIGATVKHFVCNDLEHERFSSNSIVSQRALREIY
LEPFRLAIKLANPACIMTAYNKVNGTHCSENESLISNILRKEWAWNGLVMSDWFGTYSTV
ESLKNGLDIEFPGPSKFRQWPIVKHLLQSKEGDLSEEDHINERCRHVLSLMKFVKQNNLD
VHGYSTTEDALNNTKETSSLLRELGAETIVLLKNNNNILPLSAEKDSIAVIGPNATAFNT
YSGGGSASLNPYYVVTPLQGIQSKLGGSKKVAYTIGCHAHKALSGLLEVLTNDLDPSKNG
SKASFYLKSAQDRKVAKEVPIDTKIVNKSFVTLFDYDNQKINPKTKEFYIDFEGYLTPKE
TGDYQFGVQVFGTALLYIDDKLVIDNKTTQTKGTFCFSSGTIEETAIVYLEAGKKYKITV
EYGSGFTSKIATDFGGGGLQVGFTKVIDAQEEIAKAVELAKSHDKVVLCIGLNSEWESEG
YDRTDMSLPRKTDDLVSAVLKANPNTVVINQSGTPVEMPWIADCNAFIQAWYGGNELGNS
IADVLFGDVVPSGKLSLSWPKKNEDNPAYLNFHTEMGRVLYGEDIFVGYRYYDKLQRTVL
FPFGYGLSYTTFEFEHLEVSPLFDEGKLNVACTVSNTGDYAGKEVVQLYVGAATCGNVTK
PVKELKGFKKVFIEKGSSVKVGFELSIRHITSYFDEFKGRWCSESGDYRVFVGRSSDELP
LFGKFTVKETTYWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	251	5.5e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.13e-80	70	838	120	756	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.22e-63	329	709	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	3.67e-63	31	386	48	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.34e-44	18	803	60	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.28e-35	70	290	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG74622.1|GH3	0.0	8	856	2	840
QPG75292.1|GH3	0.0	8	856	2	840
QPG75036.1|GH3	0.0	8	856	2	840
AKS48904.1|GH3	0.0	8	853	2	837
QOU18842.1|GH3	0.0	8	853	2	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	9	856	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	9	856	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	1.36e-137	10	850	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.38e-112	15	847	9	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.90e-107	11	849	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	9	856	4	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	2.29e-277	10	856	5	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.25e-270	10	856	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.25e-270	10	856	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.31e-268	10	856	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SSD61776.1.