CAZyme Information: SSD61347.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD61347.1
• CAZy Family: GT39
• CAZyme Description: related to Trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948		107630.98	6.4362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000663:513-3359(+)

Full Sequence      

MTGDTSKEKKFTGRIINCVTRLPYKITKVFDHSTKNAVNWKIEHVTGNSALHSSLSYIQE
NTDYEEIIVGWTGEISTEEQNPFVINTNTSNTTVNNKENESPEHGANLSNQKAVKDDAAT
SSNDTNRTVNEEEQDLNEALKLSATGDINLLANKDDPLYLTQEDKDYLTAEINCKYSSSG
DNDKKKSKNTIHPVWLLRRDQERWRQYADNILWSDFHYILSPIQDSSSEKPWWFDYVKFN
EAYAMKICQLYRPGDIILIHDYYLMLLPQILRMRLGTGDVKQKHVSIGYFHHVTFPSYEY
FRCLPYRKQLLDGVLGADVLFFQNSGFARHFGSCCKRLLDATITKKADNKDDYNISAYGA
DILVKTMPIGIDKSTLIKDSFNENIDSKVETIRSAYADKKIIFGRDRLDNVRGVVQKLQA
FDTFLEMYPEWRDKVVLIQVSSPSPMNDIKVEKQANELCSLINAKYGNLNFSPVQHYHMR
IPKSVYISLLRAADLCVVASIRDSINTTALEFVTLQGHEAEKYGHSSSLILSEFSGTSSI
LKDSIIINPWDSVAVAKSINEALSTPNENSTAINLMHEVPEVGAWTEGLISTLAQFQNLK
TSITPALNRPLLLQNYRQAKRRMFLFDYDGTLTPIVQDPAAAIPTVKLYNLLTKLADDPL
NEIWIISGRDQAFLNKWFGSKVPQLGLSAEHGCFMKGANSTEWCNLAAKYDMSWQIRCNE
IMENFTSKTPGSFVERKKVALTWHYRRCVPELGEFNARDLKNTLEKEFSKTGLEVMEGKM
NVEVRPKFVNKGEIVKRLVLTPISKKEDVLEPSLEVSIEDSVKFKRDELPDFVLCLGDDF
TDEDMFRQLNTIESEWSKISTFKKNRWGNYGFYPVTVGSAAKKTIAKAHLTDPKQVLDTL
GLLVGAVSLFESAGSVDLDDRGHAKDSDSSKQSKLNSESYYQKILDSR

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	9	593	1.8e-128	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	5.52e-179	180	904	62	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.01e-150	184	594	65	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	3.96e-148	186	595	70	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	6.17e-128	178	595	73	479	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
177855	PLN02205	4.09e-102	212	911	157	849	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJV15200.1|GT20	0.0	4	943	7	886
AJU87873.1|GT20	0.0	4	943	7	886
AJU92846.1|GT20	0.0	4	943	7	886
AJU69121.1|GT20	0.0	4	943	7	886
AJP37799.1|GT20	0.0	4	943	7	886

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.75e-148	10	590	28	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	1.12e-118	604	908	5	302	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5DXN_A	2.36e-86	604	903	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	6.65e-83	604	903	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5HUV_A	4.17e-70	182	568	66	438	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	0.0	4	943	7	886	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	0.0	14	943	10	893	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|P78875|TPP1_SCHPO	9.00e-165	12	900	36	809	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54NU9|TPSB_DICDI	1.75e-126	198	854	133	755	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14145|TPS2_SCHPO	1.16e-115	207	900	172	846	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SSD61347.1.