CAZyme Information: SSD61312.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD61312.1
• CAZy Family: GT34
• CAZyme Description: Glyco_hydro_3 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A376B9I6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
994		112076.74	6.7580

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000647:2578-5562(+)

Full Sequence      

MSKIYPNIIHSIDTLSSSENNGHTNRMYKNEQEIIDTVGKLFLTGFDGTEVTNEAKLLIT
KYRVSSMILSGKNFINASQTKKLLKDLQTLAFNSGYKYPLIFCIDEEGGMLNSLFDKKYL
TQFPGAMALASTGSEEVVYQVYKKLAIELKSIGFSMYLGPVLDVLKNINPLQQQMIGVRS
FGYDPAVVTKFGKAAAKAFKDTGMFNCGKHFPGYGSATVNSNVELPMVLENTEQLLNFNL
VPYKNLIDEDLLDSVLVGGCAVPRINGNAIHACLSPTIVNNLVRETLNFEGVIVSECLLM
EALDRTFGVVQGCISAFSVGCNLVMLCSNFKIQEEAMNALKSVIADNILEKKVVEDSVAK
IENLQKKLPSWSEVLNLKDLSSKTLKEDRLLSKLAYEKSIAIVRDNGIPITNFLKPGLET
ENTILLLTPLITPLYETIDENGNRSHINSNGMHKDLRYGEDVFVELGRQLAAYKEGYKVL
HQSYNSNGLTTFHEELILKSKVVLFVSAETTRNLYQVGVAKHVFILCNQTRARNKAAQMI
IISVSSPLDFLYDINFGTTPTGYICLYDYTKNALSNLPHVLFGDLKPTGKIPGISMSNGK
LGTLDMQRNKDTDKKGKNSWLVETFNFSRDWDKLITLLKNNNIVDYSASDISLKNWENFF
KTENQALTCFVIRNTSSNSILGISVTWISTDFEDIKSCIGNILLLLVDKNKRGISIGSHL
YTRTMKYFFDECSCFKVYLCGEFPKLYIKNDLLLEATEENRSSLNFFGSFSWDFDLFKKR
GNENNSVIRRDIYRDMRYLLKLDDVSSWKVSENLVRQLQVVGIMFDICKNPEEIIRCYKN
KHVLKSAPVAENYELYLEIYQSLLSDDNEYLADGNLNIIVALEPNKRSVVGSLIVFNNNS
KFAKFYPFLDSGDADVGYSCIAGHFIDPLYYTLSEVFKLGLICTALMYIKSRTQGTEYPC
YIVDIEGKQLNSLHDNGFQTLSKYHNFYSEVKNT

Enzyme Prediction     

No EC number prediction in SSD61312.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	96	325	8.1e-45	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.72e-57	40	407	6	345	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.51e-51	36	364	4	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	3.71e-29	48	376	10	318	beta-hexosaminidase; Provisional
185053	PRK15098	1.38e-04	121	296	118	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU77568.1|GH3	0.0	38	991	50	1073
ABN65475.2|GH3	1.42e-221	38	993	11	1003
AOW30790.1|GH3	4.47e-213	39	988	7	948
QRG36182.1|GH3	1.14e-212	36	988	5	980
QWW22451.1|GH3	1.78e-211	36	988	5	980

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.79e-61	30	775	5	682	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	4.75e-51	38	592	17	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
5BZA_A	2.39e-33	38	406	5	354	Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_B Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_C Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_D Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_A Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_B Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_C Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_D Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana]
3WO8_A	4.01e-32	38	385	16	344	Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8],3WO8_B Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]
3BMX_A	6.77e-32	49	365	71	393	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48823|HEXA_PSEO7	5.63e-35	49	410	49	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|P40406|NAGZ_BACSU	3.48e-31	49	365	71	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q6LJ30|NAGZ_PHOPR	3.49e-28	48	351	10	301	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1
sp|Q2KXM7|NAGZ_BORA1	3.90e-27	48	340	21	306	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
sp|Q7WH65|NAGZ_BORBR	5.57e-27	48	372	22	327	Beta-hexosaminidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999678	0.000332

TMHMM  Annotations     

There is no transmembrane helices in SSD61312.1.