CAZyme Information: SSD61142.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD61142.1
• CAZy Family: GT22
• CAZyme Description: CBM21 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A376B911]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	UFAJ01000582|CGC1	51979.23	7.3876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000582:1892-3250(-)

Full Sequence      

MPYQAATILPIRSVTDNKTIKPIKGCTKPNSFASDTSKVTSAPKNHLSSLSFLHKPKRNR
PIRDQMLEDEKLLSLNTELNKIIKQKKNEDIDKGETYYKPSNAKLDNFNIKYFDTTFLGD
DEIGPKNEATDIYTSTFDDDDKENAIDDLNDSIKDFRPFNNRSKDDTNERLNIIRKKSGE
IVKSNLKRSKSLPIGRSVSAGDNSISQPNHHGRSNSVHFEESRQVKYFDELEAPCNLKNN
TNQNTSRRKSKKFMSTAAANTNKPQFGISQSESNNEYATNNSTPSFLKFTGLDCSLLESL
SPMSEINIDFCKQLMCNKHVFPLTLQIDMEYTSGGAPFHKLSGFIVVQNMFYDKQVIFRY
TINGWLTWKDLQCKWFKHCDDDDVLLSDYDIFQFELPDIDKIVQDTNVLQFCLEYKSWNK
GGVEHVFWDNNDSNNYTLKFSSGKQKNIYYPQ

Enzyme Prediction     

No EC number prediction in SSD61142.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	339	437	1.1e-22	0.8317757009345794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	3.13e-19	339	439	19	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	3.68e-06	349	438	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD6622378.1|CBM21	1.52e-16	47	438	56	533
NP_010974.1|CBM21	2.03e-16	47	438	56	533
AAB64590.1|CBM21	2.03e-16	47	438	56	533
CCE94073.1|CBM21	2.55e-16	47	438	44	434
CAD6624066.1|CBM21	2.71e-16	47	438	56	533

PDB Hits     

SSD61142.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40036|GIP2_YEAST	3.61e-17	47	438	56	533	GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1
sp|P40187|PIG2_YEAST	1.04e-12	47	438	50	507	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
sp|Q6DDQ5|PPR3C_XENLA	4.15e-07	340	451	149	250	Protein phosphatase 1 regulatory subunit 3C OS=Xenopus laevis OX=8355 GN=ppp1r3c PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SSD61142.1.