CAZyme Information: SSD60952.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD60952.1
• CAZy Family: GT2
• CAZyme Description: related to Chitin synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1203		136825.47	5.8324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000512:580-4191(-)

Full Sequence      

MSYKNISNTDDTDQNQKKYNNSTNNDTDISSPTDPYGSFIKKFENNQNDTQSSFGVSSNH
YSDIFNTNNNTNLASNTNSAYNNIINYNHGNTNNNNNNNNMNEAYQLHDFDEFEINRHTE
PLNFSQHSNSSIKLPKTTTTTATNTDTDNYYNNNPLPSITVIPATSNINHNLTQSTINSP
SGTVIPNTKPITYNRPSFEYDTNANVDNRDSFISTTNNSETRLVPPSPEIHPLFIKRNPT
SNDSYINDGNSIIHGNTNNFDEVTSIFNLNGDLEGGPIEQQGDDYPINSYINKQGNMVNP
YSQKNTFINPETYQMFHTNTHDNVNRNLSLAYKGRSTNKSPSRNKNLEQHFDLGEYSNSN
KNNSRNFANSSYDNEENDGFNEDDEYDIDSQEGSYEYETEDEDDSSTHTSLTKKYSATGE
TEYEAKDDDTASSKVLSVGKKGFPQRLRTVRRFLLDNGNFVFDCPLSESLLSNYAKSVDD
PSKLSNEFKFMRYQAVTCEPHLFSQENFTLRQLKFLVPRRTELFIVITMYNEDEILLSRT
LKGVFDNIRHTLKKKNSLTWGADAWKKIVVCIVSDGRSKINPRSLALLSALGCYQDGFAK
SEINGKQVITHVYEHTTKVNIASVDENGVQLVCDQTTVPVQLLFCLKENNQKKINSHRWA
IEAFAESLQPNVIVLLDAGTKPGKDSIYELWKEFEDPQVGGACGEIRVDLGGSFKDLFNP
LVAAQNFEYKLSNILDKTTESNFGFITVLPGAFSAYRFEALKGEPLQKYFMGDNMQSIKL
FLSNMYLAEDRILCFEIVTKKQSNWVLRYCRSSYGETDVPSRIPEFILQRRRWMNGSFFA
SLYSFVHCHKIWTSGQSFLRKIGLTIESLYLFFNTLISWFSLSSFFLVFRILTLSIAISY
YDIVCFRILSMILYWLYCLTLLTTFILSLGNKPKGTPTFYLIVFIFFAILFIYVVFCSIY
LSVNTVEDVVDEDHVTFTSLMKSEPFRDLIVSMGSTYVLYFASSVIALQPWHMFTSFIQY
LLLSPSYINVLNIYAFANVHDISWGTKGSVAAKSLGKVESKKDGSVKTEIPISAAEIENN
YQKFIKELSTAPAVNSESEPSLDEKKTSYYAMVRSIILIVWSVSNFAVVAVVLEIGSLSE
FQNMQKDDTKDVTSTVTILGRRSTIYFSVILWLVAAMAAIRFIGCSLYMLKRSCKKLFTR
RQY

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	529	694	2.5e-69	0.9938650306748467
GT2	672	924	3.6e-16	0.47248576850094876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.59e-93	529	694	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	4.36e-81	525	840	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	8.75e-35	643	966	115	413	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	5.03e-28	452	528	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	3.44e-18	642	762	55	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAR21671.1|GT2	0.0	276	1197	190	1050
AJT05691.1|GT2	0.0	155	1200	135	1131
CAD6644021.1|GT2	0.0	155	1200	135	1131
CAD6640975.1|GT2	0.0	155	1200	135	1131
AET40807.1|GT2	0.0	268	1197	163	1024

PDB Hits     

SSD60952.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P08004|CHS1_YEAST	0.0	155	1200	135	1131	Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS1 PE=1 SV=2
sp|P30572|CHS2_CANAX	1.68e-247	457	1192	244	996	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30583|CHSC_EMENI	1.91e-238	445	1192	172	913	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P30588|CHS3_NEUCR	5.71e-238	445	1192	145	883	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30601|CHS2_EXODE	3.25e-236	445	1192	181	916	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000009

TMHMM  Annotations     

Start	End
870	892
904	926
941	963
989	1011
1015	1037
1116	1138
1163	1185