CAZyme Information: SSD60456.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD60456.1
• CAZy Family: GH72
• CAZyme Description: related to DUF1237 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		72548.00	7.6345

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000358:1419-3308(+)

Full Sequence      

MIIIRKKYRPIFLALIVFLIYKCYPSNSTYNNDYDNSEQKLSLTKEKLKKQPPHNADNND
LRPLSNGKSGVFTNNKNPMFYQNSVKKCINYMEYSSVKHYLETDDISDPLTLPFQRPPKN
CRTFHSDIIEIVIDELKKRFKDPRLSRIFENAFPNTLDTTILFHVTAEENSKLSKKNHNN
PRTAYRNMLPESFIVTGDIHAEWLRDSSWQLSVYQPLIKYDSKLLELIRGAINTQSQLLA
SNPYCNAFHPLPYMKVSKVPGHIDRVRPSPNWAHVFECKYEIDSLAAFLTLTREYYENAP
RVDDMEKKFITKDWLRALSQLMLVLNREKTPTFQKDTGNVNNFNYIFQRDTNIGSETRPL
AGTGNPAKYDINLIKSAFRPSDDATIFSFFIPGNAHMAVELKKMAAILEKLKDYIHVNDL
DNFINVDKTLEAMMVYALNIETGILEHAVFQDPKHGQVLAYEIDGYGSKLMMDDANIPSL
LSLPDLGFLNVSDPLYQNTRKMILSRDGNPYYLKGPYFEGIGGPHIGIHNAWPMSLTMAI
RTSNDDAEILKYLDLLLSNTAGLGLIHESIQVHKPNGQQYTRPWFAWANSEFAKTILHLA
EHKPDLIFKEEYWGKPFVLKDLDQYRIVD

Enzyme Prediction     

No EC number prediction in SSD60456.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	142	597	1.6e-148	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	142	597	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.01e-135	121	606	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAR21888.1|GH125	8.60e-234	81	621	58	591
XP_452162.1|GH125	9.89e-234	81	621	69	600
CAH02555.1|GH125	9.89e-234	81	621	69	600
QEU59442.1|GH125	1.40e-233	81	621	69	600
QGN15052.1|GH125	1.27e-224	81	621	67	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	2.16e-88	116	607	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	4.03e-88	116	607	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	8.87e-88	116	607	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
6RQK_A	9.92e-64	127	596	10	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.13e-63	127	596	10	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	4.26e-153	86	609	25	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998870	0.001176

TMHMM  Annotations     

There is no transmembrane helices in SSD60456.1.