CAZyme Information: SSD58651.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD58651.1
• CAZy Family: AA4
• CAZyme Description: probable Dolichyl-phosphate-mannose--protein mannosyltransferase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		88625.15	7.5076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000032:24364-26670(-)

Full Sequence      

MGLNHRKKSPIPSAKPVQNNQINIDDDSKNKYIKKKSSYDYLATKYLLQSPPDSQSTYNL
YCGIVTLIAFIARFYLINYPKEVVFDEVHFGKFASYYLERTYFFDLHPPFAKMLIAFIGY
ILGYDGKFKFDEIGMSYDTNPAPYIAYRSLNAIMGTLTVTFMFNTLKELNFKAITCALGA
FLVAVDNAHVTETRLILLDATLIFSIASSIYCFVRFYKEQLREAFTKAWFLWLYLTGISL
SFVTSTKYVGILTFATIGIAIVFNLWQLFDIKAGLTLKEFSKHFLIRLHALIVVPFIIYL
FWFYVHFSILTKSGPGDEFMSPEFQETLGESPLARDSRDLNYFDVITLKHLSTDAFLHSH
LANYPLRYEDGRISSQGQQVTGYSFEDVNNEWEVVPTKELPAKLGQPVAFNDVIRLRHIA
TNTYLLGHDVASPLYPTNEEITTVPPESANGENFQETLFRLEPLNKNEEGTPIRTKASRF
RVIHVDTNVALWTHNDVLLPDWGFDQQEVNGNKKITDPENTWFFDQIINIPPERDVSIKK
TIKPMNFFRKWWEAQTKMFYHNNHLTSEHPFASDPQSWPGSLSGVSFWNKDQERKQIYFI
GNIIGWWAEIATLSLFCGIVLADVLTRRRSVYTLGKIPRARLYGPLMFLFIGWSCHFLPF
FLMSRQKFLHHYLPAHMIAAMFTAALIEWGFTNNKSLDSSKDEELPEVPYEEHPAIKVKK
LTFVFVILALAVFAFFIYFSPLVYGNVGLTPAEAKARQWLNIELHFTK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	65	307	1e-68	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	51	761	16	691	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	4.61e-82	64	311	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	3.99e-68	549	761	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.32e-24	348	523	3	184	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.19e-09	338	396	2	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDF91290.1|GT39	0.0	1	768	1	761
AQZ18398.1|GT39	0.0	1	768	13	773
AQZ15690.1|GT39	0.0	35	768	40	773
CCE91622.1|GT39	0.0	6	768	4	763
QLL32473.1|GT39	0.0	26	768	21	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	4.08e-97	71	761	62	725	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	9.21e-78	64	689	70	700	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
1T9F_A	4.06e-07	343	448	10	109	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46971|PMT4_YEAST	0.0	4	768	8	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	2.60e-277	2	768	10	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	6.69e-207	64	761	64	768	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|F1QF89|POMT1_DANRE	7.77e-101	65	675	21	642	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q2LZ62|POMT1_DROPS	8.82e-101	59	759	197	893	Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999691	0.000317

TMHMM  Annotations     

Start	End
55	77
102	124
144	166
173	190
195	217
230	263
283	305
603	625
640	662
669	691
723	745