CAZyme Information: SSD58366.1

Basic Information

• Species: Saccharomycodes ludwigii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Saccharomycodes; Saccharomycodes ludwigii
• CAZyme ID: SSD58366.1
• CAZy Family: AA1
• CAZyme Description: related to Glucose N-acetyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	UFAJ01000008|CGC1	58324.89	5.3299

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SludwigiiUTAD17	4017	N/A	2	4015

• Gene Location: location=UFAJ01000008:12901-14394(+)

Full Sequence      

MFFISKRKLKLLLLIAFLFIAISFAVDEIIKFQLNKEIQFYKKIFKDSNEHGFYDPINIK
QIPSKTIQEIYDQKLSLSLSKENEGNDNKKVHTAINWDKYAYASYVADATYLCNTLIQFK
SLLDKGTKAKLVLLISKDILDEESARNNLEKLRNFNSDQIILKEIESVVKTLEKNVWDKS
LTKLLIFNETDYNRIVYFDNNAMIRDKMDELFFIPEYIDFAAPLNYWDLNEGDIEEAYND
VRIREKWPIKLSTYTQKLRKKVTKNLEIYNDLPNLPPSLFLSTDNVAKEIIKASSRGSPL
SRLWGSDVDNDKLKFSTNLMVIKPNSEYYYDIVNTVIPKYLNEDEKNDVDIINEELYNLK
KIIYFQFRFFKKLRSRFMPKVLILPFREYGLLSSSIRDLAHYDMIYNDVLGYYNGEIDPS
GSSVMGLIEHSSKYIHFSDPQIEKPWVYSSMDEIKCQVGLFPTGPIAPESFEQDVQACSV
WNELYRNFLDARDEVCY

Enzyme Prediction     

EC	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	87	448	6.4e-18	0.9377431906614786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	2.75e-76	100	488	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
227884	Gnt1	5.65e-27	24	370	18	306	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133018	GT8_Glycogenin	1.84e-13	100	232	1	131	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	6.09e-10	100	233	1	138	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
410780	HopN1-like	0.002	365	440	88	172	peptidase C58 domain of Pseudomonas syringae type III effector HopN1 and related proteins. This family includes the C58 peptidase domain of Pseudomonas syringae HopN1 peptidase, a type III secretion system effector that can suppress plant cell death events in both compatible and incompatible interactions. HopN1's proteolytic activity is dependent upon the invariant C/H/D residues conserved in the C58/YopT family peptidase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS76400.1|GT8	9.41e-148	4	497	4	490
AJT79561.1|GT8	3.05e-146	4	496	4	489
AJU10320.1|GT8	3.48e-145	4	496	4	489
AJU01536.1|GT8	3.48e-145	4	496	4	489
AJT78092.1|GT8	3.48e-145	4	496	4	489

PDB Hits     

SSD58366.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12096|GNT1_YEAST	1.24e-145	4	496	4	489	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q6FQ15|GNT1_CANGA	2.53e-142	4	492	4	484	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q6CT96|GNT1B_KLULA	2.76e-118	6	492	3	447	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1
sp|Q9Y761|GNT1A_KLULA	1.42e-85	54	496	64	458	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	3.30e-27	58	446	43	399	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.844006	0.156001

TMHMM  Annotations     

Start	End
9	26