CAZyme Information: SPSK_09776-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_09776-t39_1-p1
• CAZy Family: GT50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	AXCR01000007|CGC20	25395.39	6.4852

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:4998170-4998883(+)

Full Sequence      

MHAPSMLLAAAAFLGSAVVAAPAELAATAPAAGKLRIMPLGDSITEITCWRALVWDMIAE
AGYADKVEYVGSQKSNPQNCKPQTANWDQHHEGHSGWLAIDIANNYITKWMANTPADIVM
FMLGTNDVTGRHKTADIMAAYTKIVTVARAANPKIKIIVDKVLPLPVMPQGVIDINKAIP
AWATGLNSTDSPIVIADCNTDFPTSDLRDGIHPNLSGDKVMASRIGPLLLNFIKESL

Enzyme Prediction     

No EC number prediction in SPSK_09776-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	35	223	4.1e-51	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.94e-38	35	222	1	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.12e-14	40	217	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.11e-10	40	228	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238879	NnaC_like	1.75e-08	40	237	6	174	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
225353	TesA	3.99e-08	115	237	77	216	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64701.1|CE3	2.72e-114	34	237	30	234
AEO59370.1|CE3	3.66e-105	14	237	12	233
VBB79507.1|CE3	2.95e-101	34	237	87	291
CDP27869.1|CE3	2.95e-101	34	237	87	291
CAP61514.1|CE3	2.95e-101	34	237	87	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	3.65e-63	35	235	2	205	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	1.04e-62	35	235	2	205	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	1.56e-07	31	236	40	267	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000495	0.999473	CS pos: 20-21. Pr: 0.9593

TMHMM  Annotations     

Start	End
7	29