CAZyme Information: SPSK_09565-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_09565-t39_1-p1
• CAZy Family: GT34
• CAZyme Description: phosphatidylinositol glycan, class V

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	AXCR01000007|CGC34	34504.72	8.4614

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:3451102-3452094(+)

Full Sequence      

MTTQSGAAGTAPKAATLLNHTQHPYWSLAVVFGAWKSCLLAIAVLAAWAGPAYDTSGDLL
QVIASSNGTTPYASATGGHAIPSGGIVSRLTSWDAIYYVEAARRGHVYEQEWAFGAGLPL
VVSLARRALAGLGVDAPVAVVAVAYVHIAHLLAVFALYRLGCQLWEGAAGRTTAFVAACL
HVLSPAGLFLSAPYAESSCALFSFVGYAALAAGRTQGLSVKGDALRLLAGAAFGVATLFR
SNGLLNGVVFAYEAVHGAVTFLQQPSPRLLRRLVSIGLGGLAVAAGSVVPQVVAYFEFCI
EPSGVPSEVRRPWCAQRPPSIYNFVQDHYW

Enzyme Prediction     

No EC number prediction in SPSK_09565-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	32	330	1.3e-69	0.6633906633906634

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	7.15e-24	90	330	57	287	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.88e-06	93	330	77	286	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58925.1|GT76	1.78e-78	23	330	19	330
VBB80094.1|GT76	3.85e-78	15	330	28	332
CDP28476.1|GT76	1.26e-76	15	330	30	334
CAP66741.1|GT76	1.26e-76	15	330	30	334
UPK97415.1|GT76	4.30e-73	17	330	3	293

PDB Hits     

SPSK_09565-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	2.77e-77	11	330	2	341	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	4.06e-60	17	330	3	292	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.32e-51	7	330	2	304	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	8.16e-44	1	330	4	299	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	4.21e-29	25	330	4	250	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000022

TMHMM  Annotations     

Start	End
28	50
138	160
173	195
230	252
273	295