CAZyme Information: SPSK_09521-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_09521-t39_1-p1
• CAZy Family: GT33
• CAZyme Description: pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		34138.06	7.5810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:3785506-3786550(-)

Full Sequence      

MLSTLVLSMCIGHAFATGRTSPPSGSITVCSSGCDYNIIQKAVGSISPTSKSPSKIFVYA
GTYTEQVTIPVLAGALTIYGQTANTASYTSNVVNLTWKSSAADGFDDEHTAALINLSPSV
RVYNINIKNTYGKGSQAIALAAYNTKQGYYGVGLYGYQDTLLAQTGNQVYAGCYIEGAVD
FVFGQYARAWITKSDIALKAGGGSITADGRPSASGDSYYVIDQSTVTAASGASVASGTVY
LGRPWSQYARVCVQKTVLSSIVNAAGWSIWSTSTPNTAGVSFQEYDNTGAGARGTRVSFA
TKLSSPISIGTILDSDYANWVDTSYV

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	303	5.4e-68	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	9.70e-35	27	305	13	274	putative pectinesterase
215357	PLN02665	6.91e-29	35	304	79	341	pectinesterase family protein
395871	Pectinesterase	2.77e-27	27	300	2	275	Pectinesterase.
215367	PLN02682	3.13e-27	23	321	67	367	pectinesterase family protein
178113	PLN02497	5.29e-26	5	304	12	307	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA16046.1|CE8	6.38e-134	5	326	5	326
ATZ56871.1|CE8	4.61e-129	5	326	5	326
CCD50540.1|CE8	4.61e-129	5	326	5	326
QSZ32978.1|CE8	2.70e-123	5	326	5	326
ARB08121.1|CE8	4.12e-121	14	326	16	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.43e-67	19	325	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.43e-67	19	325	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	7.21e-27	35	292	18	273	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.55e-20	35	292	14	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.97e-114	14	326	15	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	7.40e-107	3	325	4	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q5B7U0|PMEA_EMENI	1.26e-68	13	325	23	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q2UBD9|PMEA_ASPOR	6.86e-68	1	325	5	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	2.73e-67	17	325	26	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999645	CS pos: 16-17. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in SPSK_09521-t39_1-p1.