CAZyme Information: SPSK_09420-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_09420-t39_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		40436.81	7.3656

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:2873961-2875136(+)

Full Sequence      

MVHLISALLLAGSAMALPAREIFGIQQTCTVPASIPAVSNAKLPDPFTASDGTKVTTKDQ
WACRQQEILKAMEQYELGDFPGPPDAVKGTLTGNSLKVDITVGSKSVSFTSTIKKGSGGG
AAIITIGGSSLPIPGTVSTINFDNDGFASQASGSSRGQGKFYTLFGAGHSAGALTAWAWG
VGRLIDALEQVNATSGVDTTKLGVTGCSRNGKGAFVVGALNTRIALTLPQESGSGGAACW
RISDAEKSAGKNIQTAGEIVGENVWFSKNLNSYTAKTSTMPEDHHMLAALTAPRGLFVIE
NDIDWLGPVSTTGCMKAGRLIYKGVGAPNNMGFSLVGGHSHCMFPSAQQADLTTYINHFL
LGTGAAPGAVEKSSATVDMSKYVDWTPPTLS

Enzyme Prediction     

EC	3.1.1.-:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	42	361	1.3e-84	0.9925650557620818

CDD Domains     

SPSK_09420-t39_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL51557.1|CE15	3.38e-195	6	391	7	394
AEO68173.1|CE15	4.15e-192	1	391	1	397
UQC88905.1|CE15	6.51e-179	6	391	6	395
AEO60464.1|CE15|3.1.1.-	1.46e-173	1	385	1	389
VBB82012.1|CE15	6.01e-170	1	391	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G4G_A	2.24e-170	1	385	15	403	Crystal structure of recombinant glucuronoyl esterase from Sporotrichum thermophile determined at 1.55 A resolution [Thermothelomyces thermophilus ATCC 42464]
4G4I_A	6.40e-170	1	385	15	403	Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile determined at 1.9 A resolution [Thermothelomyces thermophilus ATCC 42464],4G4J_A Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile in complex with methyl 4-O-methyl-beta-D-glucopyranuronate determined at 2.35 A resolution [Thermothelomyces thermophilus ATCC 42464]
3PIC_A	6.73e-136	28	391	10	375	Chain A, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
6RU2_A	3.06e-110	31	391	6	380	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RTV_A	8.15e-110	31	391	12	386	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S1X0|GCE_NEUCR	1.94e-180	1	391	1	394	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2
sp|G2QJR6|GCE2_MYCTT	2.59e-174	1	385	1	389	4-O-methyl-glucuronoyl methylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=ge2 PE=1 SV=1
sp|G0RV93|GCE_HYPJQ	5.86e-134	28	391	95	460	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
sp|B2ABS0|GCE1_PODAN	6.08e-123	42	387	122	474	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
sp|D8QLP9|GCE_SCHCM	3.67e-116	5	391	3	393	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999765	CS pos: 16-17. Pr: 0.9642

TMHMM  Annotations     

There is no transmembrane helices in SPSK_09420-t39_1-p1.