CAZyme Information: SPSK_09150-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_09150-t39_1-p1
• CAZy Family: GT2
• CAZyme Description: phosphatidylinositol glycan, class M

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	AXCR01000007|CGC6	52416.27	9.9257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:2876835-2878342(+)

Full Sequence      

MASPPVTRRRVQLQERKKEKVEEFQDSRTYRTATFFGNATAVYGAAAALRIVLLVYGLWQ
DANSPVKYTDIDYLVFTDAARFVAKDGGSPYDRETYRYTPLLAWLLLPTAAEAGGVLGQQ
LLFASGKVLFAAADLVAGWLLERVLREQLRVASPAHATTARIYASVWLLNPMVAAISTRG
SAEGLLGALVAALLWAVHVARQPLLAGLLLGAGVHLKIYPFIYAPAIVWWMDADNMGQSG
GRAPAKVSKKNSKKVDKPVYPILAFVTPARLQLAGASLAIFVGLNVVMYSIYGFPFLQHT
YLHHVTRIDHRHNFSPYNTQLYLSSAAAAAITGGAANSTIAAATSTTPWLPPIESLAFVP
QLLLATVLLPLVLAKKDLPATLLAQTFAFVAFNKVCTSQYFLWYMVLLPVYLPQSSFVQS
PRKGVLALVLWVAGQAAWLQQGFLLEFLGQSTFVPGLWLASLGFFTVNCWILGVIVGDVA
GA

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	176	476	2.5e-90	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.79e-77	49	476	18	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.25e-57	214	476	38	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54528.1|GT50	1.19e-184	35	479	21	427
VBB81264.1|GT50	3.19e-183	34	479	26	442
CAP65259.1|GT50	6.01e-181	34	479	26	442
CAD60578.1|GT50	6.01e-181	34	479	26	442
CDP29471.1|GT50	6.01e-181	34	479	26	442

PDB Hits     

SPSK_09150-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	9.32e-174	33	478	20	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	2.72e-165	34	482	3	424	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	2.07e-162	33	480	2	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	5.44e-162	34	481	3	430	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	4.91e-155	36	478	7	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000031

TMHMM  Annotations     

Start	End
35	57
175	197
204	226
275	297
321	343
353	375
388	410
425	447
454	476