CAZyme Information: SPSK_08637-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_08637-t39_1-p1
• CAZy Family: GH94
• CAZyme Description: family 31 glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	AXCR01000007|CGC35	87710.55	5.8549

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:6347074-6349446(+)

Full Sequence      

MKIRDGMWHTAEGMSVNYAEEIYETTSTPRGIRLLCPTGKIRSRGDTLNQPTVTLTIEAE
SDGIVSVEVVHWDGELRRGPNFALFPHGRLAVDAVVTNDALSTTVASGTVAATVTTNNGD
GSRAFGIRFHPVAAGESRHTLTSLGHRSVGFVISPAISNPQQIETMSDKTHYIFSQTDLG
VGESIHGLGERFGGFNKVGQQVQLWNADGGTSSEQAYKNIPFWLSSRGYGVFLDTPDRIE
LEVGSARCSRVEALVRGQRLKWYLIYGPTPRDVLHRYSLLTGQPNTLPPWSYGLWLSTSF
TTNYDESTVQRFLSGMRDRGMQVDVFHFDCFWMRAFTWTDFVFDSERFPDPAGQIARLKA
SGLCRKVCVWINPYIAQNGAAFSYAAEKGYLLRRPNGDIWQWDMWQAGMGLVDFTNPDAC
AWYAASLDKLFDIGVDAIKTDFGERIPTRDIQWYDRSTDPSRMHNYYTLQYNRVVYEALI
ARFGTGQGVLFARSATAGTQRFPLHWGGDCESTAVAMAESLRGGLSLGLSGFSFWSVDIG
GFEGAPPPWIYKRWVAFGLLCSHSRLHGSNSYRVPWTIDDDDRSPGSATTTLARWTALKI
RLLPYILAQSHESVAVGLPVSVRATCIEFPDDPTAWTLDRQFFIGSSLLAAPIFEEDGEV
EFYLPRGRWTSFFTNKVRIGPGWFRERHGFGSLALYVRDNTILVLGSTNTAGHSAVYDYS
NDNEVVTYGAKPGAQTAVVDVDGKICGSLEVDQDGNLVGTNVLTGNWTCSRDKRVLEDTV
TIEEIIDLTV

Enzyme Prediction     

EC	3.2.1.177:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	262	703	2e-113	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	0.0	172	744	142	708	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
236731	PRK10658	0.0	1	700	1	665	putative alpha-glucosidase; Provisional
269879	GH31_xylosidase_YicI	1.08e-164	282	602	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
395838	Glyco_hydro_31	3.19e-148	263	703	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
236691	PRK10426	1.41e-70	182	702	81	622	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF3761306.1|GH31	0.0	1	778	1	768
UQC73623.1|GH31	0.0	1	765	277	1033
KAF3342862.1|GH31	0.0	2	771	3	763
AEO68569.1|GH31	0.0	1	766	1	758
AEO60478.1|GH31	0.0	1	766	1	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	9.11e-232	1	772	1	740	Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	1.08e-231	1	772	1	740	Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	1.73e-223	2	772	2	740	Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	1.40e-98	183	703	202	715	Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	5.67e-56	183	703	156	688	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31434|XYLS_ECOLI	4.53e-231	1	772	1	740	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q5AW25|AGDD_EMENI	1.16e-222	1	702	1	695	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
sp|P96793|XYLQ_LACPE	7.77e-199	1	768	1	739	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	6.85e-49	183	728	147	704	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q9P999|XYLS_SACS2	2.46e-48	169	718	98	637	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000003

TMHMM  Annotations     

There is no transmembrane helices in SPSK_08637-t39_1-p1.