CAZyme Information: SPSK_08488-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_08488-t39_1-p1
• CAZy Family: GH88
• CAZyme Description: glucosylltransferase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	AXCR01000007|CGC3	95204.23	8.3719

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:6310971-6313808(+)

Full Sequence      

MQSQRDYYDDGSGADQSYGNPVEMHDMNNRSPPYQRMPPPRPQRQNANNVQPPAADQYSY
VPQAQDDGYATPSPYQERPDRRWMTGPPSTDFSRPLVSPRQAPIYQSAHTSSTAVDMDGD
NASSGSPPWAMNLNNSSGFLTESHNMYNSGFHSNMSSPRNSARASTTDLAFLKRHKAMSS
MTDSRPPSRDQSHVTLTNLLNQTPEPVLSEDWVVPGTVAQIHNRDDADTWKGWRRLVYKF
TPYLTVLNMGLYLLYLTYRIICIVSAQNRFRTVFAAAWLFVAVEVATAIPSLMHNCWTVM
AIHKRRRPKLRWMGDDAPTVDVFITCCKEDNDVVMDTVRGACDLDYPRKRFRVIVLDDGA
VESLAKEVEALSATYPNLMYIARPKYPGVPHHFKAGNLNYGLDASLSFPGGAGEYMAALD
ADMIPERQWLRAVIPHLVVDPKMALACPPQLFYNTPPGDPLAQSLDFFVHVIEPIKDTMG
VAWCTGSGYVARREALTEIGNFPLGSLAEDVATSTKMLGKGWKTAFIHEPLQYGTVPDDF
ASHLKQRTRWAIGTVDTSFKLNFCLWGDSVRQMTFAQRFSGFLYASLSLYTILLNISLFA
IPVILLLGKQLVAYADENQLRWLVRACFAAMMSNRLCELVMFIPAGYHTGQRGSRYQLWM
SPYIALCLIRAFALPKWLGGQAQAFTPTGSISSKLNERDARMRKNMVKRLWAIVVNYMGW
FHMIFVYITLVGVAMSTYRCFFWYTSVKAVLQGLVTHAYWPPLTFLFICSSMWTPIAYAI
DPPSMPDREELLNRDPKTGVAHPTDKAKKIAMNGQTAWYELEYTTTTLYTTLIFVMSFLP
FLF

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	319	552	1.1e-20	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	9.85e-100	318	557	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	3.71e-41	271	607	7	336	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	4.35e-31	318	602	260	555	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	3.66e-24	326	555	6	229	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
133045	CESA_like	6.55e-24	322	510	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64665.1|GT2	0.0	183	839	119	776
UKZ72516.1|GT2	0.0	156	839	65	753
UKZ45919.1|GT2	0.0	189	839	2	656
UNI18447.1|GT2	0.0	190	841	115	769
XP_748682.1|GT2|2.4.1.-	0.0	191	838	78	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.66e-24	318	578	273	521	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	4.66e-24	315	553	125	374	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.40e-24	315	553	137	386	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	5.41e-24	315	553	138	387	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9WX61|BCSA3_KOMXY	1.05e-32	298	670	130	479	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	2.86e-32	243	670	77	479	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|O82859|BCSA2_KOMSB	3.40e-32	298	670	130	481	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	2.43e-31	298	670	130	479	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	1.36e-30	210	585	49	407	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
240	262
277	299
582	604
656	674
710	732
758	780
817	839