CAZyme Information: SPSK_08462-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_08462-t39_1-p1
• CAZy Family: GH81
• CAZyme Description: alpha-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933	AXCR01000007|CGC24	104898.34	6.1532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:3370845-3373780(+)

Full Sequence      

MGSINTTGKLNVASCGIHGFGEAIGIDVDELRFFWKLESTDEHARQCAYRVVVSTNKPVH
GQSLTAPCFDSGRVDGPAQRNILCKPDHGFRPTAFHYWTVQVWDQDGNDTVSAVNEFYTS
YPRSNRLLPPYSMNQTYMPHTSLIFRSWFENPDGRWKAAWIGDGGDKPIYLRTSLDLQRR
PWRVVVLASGLGHFNLSVNGQPASAHVLDPGWTDYHRTVQFVGYDVTDKILGGINVVGAH
LGNGFYAGDQGDRFFWPMYEDNTYVRYGNELCFFAEIHVHYDDGTHDCIVSDPTWKVKKS
ATTLANIYASENHDARLFPTGWDTPDFDARSWAPAKPLTGPRGKLRYQSQPPVVLHNTFT
PVRQTTVKPGVVVFDLGQNASVVPLVLAKGAAGSEYRVKYSETLGDDGLVLMPDPLFKDF
ETHVYSRIRLAGHDTPEAWSPAFCFTSARYIQIEGATLQGEREGDLVEIQSVTARHISSA
AAHLGFVKTDKDDVNALINACYWTFSSNIFSYHTDCPQIEKFGWLEVTSLLFPATQYVRD
MEAVYSKILDDIIDAQEPSGLVPTMAPLVRYMCGPMHDTITWGGAVCLLPEMIKRYYGST
VVFEKCYAPCVRYMEYMRRKERLGGLIEHGLGDWGRDVAFGNHQANIETAVYYKCLCNVA
LMARELGHAADEASYSAWADRVYANYNKHLLVTDKAEHPYAYYTSLDTPGTRDRTMVAQA
VALQFGLVPAHLREDVEAAFVAAAEDAGHVMLAGEIGLKYLWNTLADPGVDRPDIVLDMA
RQDEHPSYMRFLRRGETTLSEFWQDNCRSKCHDMLGTIYEWFYAYALGVQPLDDAYRTWR
LRPCFKAEFDYVEGTVESPYGQICVTFDRRQRTDGTVAMAVTVPVGTTCELTLPSSSTRV
ELKRQPSDSTRAHKGAALQLLQGRYTLVIDKWN

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	366	893	1.1e-115	0.9940476190476191
CBM67	166	339	4.4e-29	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	3.45e-101	482	825	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	7.09e-68	180	357	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	2.03e-16	365	478	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	3.89e-16	828	896	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02748.1|GH78	0.0	10	929	1	916
QRD91716.1|GH78	0.0	10	929	1	915
UDD64414.1|GH78	0.0	10	929	1	915
QMW35313.1|GH78	0.0	10	928	1	914
QMW47375.1|GH78	0.0	10	928	1	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.79e-75	24	931	44	943	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.94e-61	144	895	283	996	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.87e-42	163	861	126	810	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	1.40e-60	144	895	283	996	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	1.02e-54	19	897	43	882	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|T2KPL4|PLH28_FORAG	7.63e-50	24	893	44	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPSK_08462-t39_1-p1.