CAZyme Information: SPSK_08389-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_08389-t39_1-p1
• CAZy Family: GH78|GH78
• CAZyme Description: beta-N-acetylhexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1079		113964.09	6.9318

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000007:5331804-5335248(+)

Full Sequence      

MSNKLEGDLDPLWEDVDWAIGQMLIMGWDGTEVTPQIRNLIEEHHLGSVHMTAKNLKCEL
THRGDTRISPDVFRQHLTLSHLSSCARDGQDPRNAGHPYPLLIAIDQENGGVNSLFDEDY
ICQFPSAMGVAAAGSADLAYSIAKATASEVSACGVNMMLGPVLDVLTNARYQPLGVRATS
DDPQEVSQYGIAAMKGYKDMGLATCGKHFPSYGNLDFLGSSLDIPIITQTLEELSLSALV
PFRNAIASGQLDAMFVGGCGIANPSMNVGHACLSDQVVDDLLRNELGFRGVAISECLEME
ALSHEIGVKGGTVMAVEAGCDIVMLCRAYDVQLEAIAGLKLGYANGILTRDRIFTSLRRV
LNLKKSCTSWAKALNPPGLSLLSKIHPSNLALSRKAYDDSITVMRDRDRLLPLSRSMHQH
EELLLLTPLVKPLPASSATKTLENKNFISSSASSQSLHDKWVHRDRGAIMSGEGVFRGLG
RSLARARHGKLLHTSYTANGVRPVHENLIHRASTIIIVTADANRNLYQAGFTKHVSMMCS
MLRTSGQNKNLIVVAVSSPYDFAIDKTIGTYICTFDFTEMAMSALVRALFNEYSPSGTLP
GTLRKSKKVLKSRRNWLVETYNRDRDGRGLDELLQAIARASGPHLQYLRSATASSFELNN
PNIEESHLVVSNSSTQALYGFCATYFIKNSGVGIVGGLFVDPGKRNVSVGRSLHRAALRI
LSQKPGVAKLQLGSCFPGVFPGIPVVDDSGSSTAGSTGNTPSGGGGSGGGTGGASNNAVA
AAGPGSSGSAASSTASIRSWFARGGWEVAFPRRITNLVIPDLNRWSPPEGLTRHLANAGI
SFDLIQGPEIAEGVLSHVAALAGPEVVELYRYALSQGNNKTCAVVRAKVAGSKKTGNGAD
GGADFTAEEHSGDDVAEDALLGTVIVCSPGSTIANFLPPLQPLRSLHGPASRGGGSAGGG
GGGGGGSGGGNGRSASLSTEDSLSAGLAPGPNSNTFDENTATGGIVAPVVVAGAGSASTL
LLLQGLAMMAVRQNKNHRAVRSVLSWVADEAYEPLLAMQFEVLQAFDELTNTIENVSVF

Enzyme Prediction     

No EC number prediction in SPSK_08389-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	99	324	1.6e-48	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.43e-58	20	416	7	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.57e-46	16	363	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.58e-30	93	340	50	294	beta-hexosaminidase; Provisional
185053	PRK15098	3.12e-10	123	416	119	410	beta-glucosidase BglX.
178629	PLN03080	0.001	124	296	114	298	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58968.1|GH3	0.0	3	1075	2	922
AEO64229.1|GH3	0.0	4	1078	3	928
VBB79973.1|GH3	0.0	4	1077	3	921
QBZ62649.1|GH3	0.0	6	1075	5	943
UQC73624.1|GH3	0.0	8	1075	108	1023

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	5.18e-78	14	752	7	667	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.02e-48	20	603	17	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.59e-34	16	600	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.51e-34	16	600	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	8.54e-34	16	600	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.36e-33	16	600	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|B4SRK3|NAGZ_STRM5	1.72e-30	23	353	1	309	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	3.15e-30	23	344	1	298	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	5.36e-28	23	358	1	319	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1
sp|Q87BR5|NAGZ_XYLFT	5.36e-28	23	358	1	319	Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPSK_08389-t39_1-p1.