CAZyme Information: SPSK_07656-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_07656-t39_1-p1
• CAZy Family: GH7
• CAZyme Description: glucosyll transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		44241.52	7.9605

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000004:1949936-1951108(+)

Full Sequence      

MLSTGPLPRRLRSRFGLLVTGFLVVVVFLSRHILYTAWTLAYMPMVWSRDAPTFVISQAL
DNFDITFADYNASQTEAGFDYPDRVPPVMHHVVLGSRPALPAWTETRQSCLDFHQGWETH
YWTDETAAAFVADKFPEVKATWDSYPFLIQKVDALRYMVLYEYGGAVLDMDLRCKRALGP
LRRFGFVAIEAMPVGFSSGFMMAERRNPLVGAIVDSLKTYNHRWLGLPYPTVMFSTGCHF
ASTIHALQANRSDYKVLRGPDDNRDMHKLNGKVSTPIFDHLGSSAWHSFDGAAIIMLRNA
LPYLLPVLLVVGVASIVFAKRRRLRLLQRPVPHMRELLRHQHDEQQHDKYVSGSESSSTD
GDDSDDEKAFRDVSPRTASRDYPSDGSRHV

Enzyme Prediction     

No EC number prediction in SPSK_07656-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	103	181	1.9e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.30e-17	79	286	74	279	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.97e-10	103	181	4	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI15446.1|GT32	4.53e-123	23	322	28	319
AEO68738.1|GT32	1.24e-121	12	322	12	324
QYT03157.1|GT32	1.57e-119	7	322	14	322
UKZ97012.1|GT32	3.14e-119	9	322	16	322
UKZ53116.1|GT32	1.40e-118	3	288	10	290

PDB Hits     

SPSK_07656-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.55e-27	82	299	52	264	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.27e-27	55	300	36	276	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	7.72e-26	79	299	55	272	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.89e-25	103	290	74	258	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.73e-24	83	305	79	300	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000008

TMHMM  Annotations     

Start	End
13	35
300	319