CAZyme Information: SPSK_07200-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_07200-t39_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		68197.95	6.4413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000004:250467-252508(+)

Full Sequence      

MRGALFSLAATALIVGGASAGRMLDGSIAVDRAASDNVTYDYIVIGSGPGGGPLACDLAR
AGYSTLLIEAGDDQGDNPVYSELANFNTAGNDPDSRWDFWVKHSDDPVREMAFAHYTYRT
TNGSFYVGTEPPAGATPLGIQYPRAGTLGGCAMHNGGVCSLPADDDWNIVVNMTGDTSWE
APKMRKYLVKVEKNQYLPTGTEGHGFDGWLATAVQPTRWARDIALPATRVLKQMAALTGQ
NASDVANLVDKDILGDYPHKDTLSSFYNMAQHQDKGGKRSSPNNYIKATLKDPKNYPLMV
RLNTLATRVLFQQPHAGNATSRVEGTGVGAGAALPVARGVEIMSGASLYLADPRHTNANV
TKKGPVSKVWARREVIVSGGAFNSPQILKLSGVGPAAELSKLSIPIVKDLPGVGERLADN
YEGSLLALGQQPVGGGFITLLFKTPNADGPNRNIFTWCGAFSFEGFWPGFPTDYGPNEYE
CAMVLINPHSQAGTVKLASADPQVPPDINLNFFLNNGTEDLQHLADAAKLLRTAWQAAGD
PVLPFNEKHPCPGTGAGNCTDEAQRALLKTQAYSHHASSSCAIGSDTDPLAVLDSKFRVR
GVQGLRVVDASAFPRVPGAFPVLPTIMLSAKAAEEILADAKK

Enzyme Prediction     

No EC number prediction in SPSK_07200-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	641	4.6e-68	0.5145631067961165

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.09e-52	39	641	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.08e-47	39	637	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.66e-30	488	632	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.63e-11	372	639	279	579	Protein HOTHEAD
366272	GMC_oxred_N	1.21e-07	335	422	137	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP64871.1|AA3	1.05e-272	23	641	9	615
VBB81166.1|AA3	1.05e-272	23	641	9	615
CDP29384.1|AA3	1.05e-272	23	641	9	615
QBZ53739.1|AA3	2.29e-228	40	641	85	663
QRD01027.1|AA3	1.11e-200	33	639	22	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	5.30e-32	40	641	14	540	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.29e-31	40	641	14	540	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.29e-31	40	641	14	540	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
6F97_A	5.58e-29	40	640	6	531	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	1.35e-28	40	640	6	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6LGH5|BETA_PHOPR	1.35e-37	37	639	2	533	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	3.17e-35	27	636	32	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.16e-34	40	640	36	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|C3K3D3|BETA_PSEFS	1.55e-33	40	636	5	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	2.71e-33	40	636	43	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004839	0.995129	CS pos: 20-21. Pr: 0.9600

TMHMM  Annotations     

There is no transmembrane helices in SPSK_07200-t39_1-p1.