CAZyme Information: SPSK_06871-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_06871-t39_1-p1
• CAZy Family: GH47
• CAZyme Description: LysM domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1641		169883.16	5.2576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000004:713427-718352(-)

Full Sequence      

MLSLAYALFFCALGPLVSLAAASSHHHAHNKLHHRQEHNLHGARDTAIDDAYALVNASLP
AIAAANKLKLQQPRFNTYQFPPAGNASSYGRSNTTVPVIGRRGHLMANGSSTSTGSVPPF
AANSNTTSRDYIVSPELAKAARVVAEGTTNKPAGADYTDRAARLKAEHWGQTSPASGDNA
TSVSDGVEARAAAASSSFWMANMAMNGVAPYAAAANYKVWRNVMDYGAKGDGKTDDTVAI
NKAITDGGRCGQTCGSSTATPAVIYFPSGTYLVSDTLIMYYNTQFLGDPTARPTLLAAAS
FVGYAVVLTDVYIDGANGAEWYIPQSNFLRSVRNFVIDITNAPANNYVCGIHWQVAQGTD
LQNIDFYMKDGTTQQGLYMENGSGGFMTDLYFQGGNFGAYLGNQQFTARNLIFSGCLTSI
QVFWDWAWLLQGLTIIGDNTKNGPSVGITIVDGAGGSAGSTGQGVGSMIITDCVFYFVDT
AIKTTLVADNSSSFLLQNSLFVQVPVAVYDTGAAKTLLAGSSTGNVQVASWGFGNIVSGT
SGTSVFQNGNAITAPVRPASLLPVGSGNWFTRSAPTYADASIPATAIVNVKTKGAAGDGA
TDDTAALNQALAAAANASQIVFFPYGVYVVTDTLHIPLGSRIVGQAWSTIAGRGARFQDA
TNPRAVVQVGRAGDAGTVEISDMLFSVIGPTAGAVVVEWNVHEDTNSSAKGSAAMWNSHI
RVGGNVGSSLQAATCPMSTSGTPKPACVAASLLFHLTPAASAYIENFWVWTADHDLDIAS
QDMINVYTGRGVLIESQGPTWLWGSASEHSVLYQYQFSRASNLFCSMLQTESPYFQPSPG
APAPFVPGMFPDDPTFADCALPIAANSRCALAWPVRILDSTDIFVYSAGLYSWFQSYAKN
CEIGNNCQDGAMDIQRSENVWIYNLCTKAIVNMVTPLGTAVTVGRLNQNGFLASILGWLE
GATTIVGDRFAGWSVFASGSLVGLGLSSACEAALYQTVKCDDSARNLLAADAYLGSTGNK
TLTGLVCEAVCEASIAYVRQSVAAACAVTPHLPGTNVPFVSVVDRLWSNWNQTCFVDPTT
GTNCNDVIAAFPAAADIAALPVADLCSYCYTQKLKLMEASAYSGAYDNTSFAARYAYVAS
HCSLTGVGNFNGTASAVTGTTPVDVTAPVCVSGKHYTVASGDTCDSIAVANAASSATLFA
INPVLRDCSKELTVGAVLCLPQTCDTLWTVQPDDTCQSIGNATGNSMDTLVAYNTMLNRN
CSNLQPAPASEPSWGATLCVSSPGGAYAGVAASNTSTDGNGGRGNGYAPPYTQPIKPPTG
ATVAKGTNATLCAAWYVYDATLLCAQICLTNDISIRVLTLANPSLHVPTCDADLVRGTAY
CVRPLSEVELTASSALPSSSTASLTSTSTSATTSKTPSNTPNPISTDGKCGTASSKNATC
QGSTFGNCCGPSGTCGSTPAFCSGRLGCQPTFGECKPISKDGTCGAASSVDALCLYSSFG
DCCGASGKCGTTTAFCNTDEGCQSNYGTCVARVSTDGKCGNASSVDATCLGSTFGNCCGS
SGTCGSTPAFCYGRLGCQAKYGNCVPISTDGKCGSASSVGAMCLYSAFGDCCSAAGTCGT
TSAACYLSNGCQATYGTCLAK

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	191	956	3.5e-258	0.9864864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	2.47e-80	220	443	1	211	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
211316	ChtBD1_1	4.44e-10	1429	1476	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	8.87e-09	1538	1584	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	5.87e-08	1483	1529	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.08e-06	1592	1639	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC82111.1|CBM50|GH55	0.0	45	1384	43	1360
ATY64695.1|CBM50|GH55	0.0	43	1384	50	1360
EAA66649.1|CBM50|GH55	0.0	34	1384	44	1366
EAA67102.1|GH55	0.0	17	1384	26	1364
CAK47332.1|GH55	0.0	66	1384	2	1305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.56e-198	194	960	2	754	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	3.24e-184	198	958	26	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	5.70e-177	196	955	41	870	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	7.83e-161	178	938	27	764	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.59e-50	216	961	60	753	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000699	0.999288	CS pos: 20-21. Pr: 0.9814

TMHMM  Annotations     

There is no transmembrane helices in SPSK_06871-t39_1-p1.