CAZyme Information: SPSK_06445-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_06445-t39_1-p1
• CAZy Family: GH43
• CAZyme Description: Axe2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		32824.67	4.5295

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:2870848-2871887(+)

Full Sequence      

MHSFSTLAVVGGWALANAVTGAAAASAAAAPVSNTTCAESFYILIARGSGEAILPPGQFK
YPDYTGLAAKAAIDVQNQIPGVVIGGVVYPALDPTAPGNNLSTYATSEANGTAAIADEVA
AYTKKCPGVKIALLGYSQGAQVVQDALCGGLGDNAALSVAGTTGTTKGFNADPPMPQSLV
EDNVFAIALIADPTHIANTSYDHGNSTRNGVFARTNTTACDPYVAKGLYGAWCQADDLFC
DSGSSALIHTYEPLTYENQVAQFLVDRWNNVTKDAATPSGSGSPSGTASAPSGTATKNAA
GRVAGTLGQPMLAAASVLLAAWLLN

Enzyme Prediction     

No EC number prediction in SPSK_06445-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	43	267	1.3e-28	0.9576719576719577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.58e-17	37	267	1	172	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59476.1|CE5	1.15e-57	28	272	13	259
UPL03212.1|CE5	2.24e-41	25	276	13	235
QUC15857.1|CE5	5.27e-39	37	276	29	237
UKZ58886.1|CE5	1.49e-38	21	268	13	223
QLI74162.1|CE5	3.55e-37	37	269	29	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	7.78e-16	62	264	17	202	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	7.78e-16	62	264	17	202	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	2.77e-15	62	264	17	202	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	7.16e-15	80	264	34	202	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	1.81e-15	27	264	15	229	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	3.68e-14	48	270	32	231	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.35e-13	80	264	65	233	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.140305	0.859679	CS pos: 29-30. Pr: 0.3783

TMHMM  Annotations     

There is no transmembrane helices in SPSK_06445-t39_1-p1.