CAZyme Information: SPSK_06427-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_06427-t39_1-p1
• CAZy Family: GH43
• CAZyme Description: esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		38237.79	4.9814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:2904895-2905977(+)

Full Sequence      

MLLNGGGRRLRIFLLTVFGLLGVIFLWATSDTDSTQLKEAVASWPAAVASHFAFDGGGSQ
DGDPGGFPYVGGGRKYDEPVPPPPALPPTGDSHDAGASSMGATGAPYFVLIGDSTTCGQA
KEGGGWGDAFLWQLARGAQGVNYGVNGALSTGYFHSPIWNAAMQEVRTNALARPVYVTVQ
FGHNDQNPNSNVTLDMYQDTLVGMAREVLEAGGTPFLVTPLARRDFDLDGTTVTDNLKDY
RERTLQAHAVLQDDEASKKARAINLNAASLAYIGAIGKTAAFRYNKWHPLVNDTTHLNEL
GATVFARIVADLMLGHPAALVPSGERDPWAPGAGNDDGGLSGWIRPDPYMTGLVWHGDPI

Enzyme Prediction     

No EC number prediction in SPSK_06427-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	109	311	2.9e-36	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238859	Rhamnogalacturan_acetylesterase_like	1.27e-49	106	313	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
225353	TesA	3.92e-09	109	311	12	206	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238141	SGNH_hydrolase	4.52e-09	109	312	2	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	4.52e-09	109	309	2	224	GDSL-like Lipase/Acylhydrolase.
238876	Isoamyl_acetate_hydrolase_like	6.68e-05	108	220	2	115	Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ54770.1|CE12	1.42e-43	108	358	36	291
QKX59609.1|CE12	8.29e-42	106	324	36	254
QRC95279.1|CE12	7.80e-40	107	314	28	220
AEO61167.1|CE12	1.75e-39	108	358	9	226
CAP86890.1|CE12	3.47e-39	106	313	34	234

PDB Hits     

SPSK_06427-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31523|RHGT1_BACSU	3.01e-10	110	311	10	210	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992579	0.007432

TMHMM  Annotations     

Start	End
12	29