CAZyme Information: SPSK_06400-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_06400-t39_1-p1
• CAZy Family: GH43
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		39352.13	4.7950

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:929337-930480(+)

Full Sequence      

MDRPPPLVNAVYYPSWRVYKDIPPSSLRLDKISTIFYAFAIPQPDGSLGFLDEYADAQID
VDAEHGCLDALAGVKRDNPHVRTVLSIGGGAGSGAFAQIASTATGRTAFAQAARAWVHRY
SFDGIDIDWEHPASPAEGRDYVLLLQACRAVLPSPQYLLATALPVDPSVLGRLDVRGVAA
LVDHINLMCYDFAGPWSTSAGHHAQLLAPPHLPSAQSGVQYLLDRGVPPQRILLGIPAYA
RVFWDARYEGDSFQKGATDDDDDDEKEETEMDYRDVPTEWKQQGVLHVDPSRAAAWAVVP
RRRDKVSGSAFVSMDVPATVRAKAEFVRRAGLGGLFYWTGAGDAVETDESLVAAGFDALH
GY

Enzyme Prediction     

No EC number prediction in SPSK_06400-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	9	348	5.8e-63	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	1.89e-72	9	343	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	7.00e-69	8	343	1	334	Glyco_18 domain.
395573	Glyco_hydro_18	9.47e-59	8	343	1	307	Glycosyl hydrolases family 18.
225862	ChiA	1.68e-54	1	361	32	438	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	1.05e-44	12	348	4	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL03196.1|GH18	7.22e-105	9	359	7	344
AAX07683.1|GH18	1.66e-99	8	362	81	428
QBZ60170.1|GH18	3.43e-99	8	362	82	429
UKZ48464.1|GH18	3.85e-99	6	359	2	344
UNI17268.1|GH18	3.91e-95	8	359	17	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	5.48e-44	9	361	18	378	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1D2K_A	1.03e-43	9	361	5	365	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	2.81e-43	9	361	5	365	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	5.48e-43	9	361	5	365	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6EPB_A	1.03e-41	9	361	40	400	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	4.23e-48	9	359	40	398	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|Q1E3R8|CHI1_COCIM	1.07e-42	9	361	40	400	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	1.07e-42	9	361	40	400	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|C5P230|CHI1_COCP7	2.90e-42	9	361	40	400	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|A6N6J0|CHI46_TRIHA	8.30e-42	9	361	41	407	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPSK_06400-t39_1-p1.