CAZyme Information: SPSK_06272-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_06272-t39_1-p1
• CAZy Family: GH33
• CAZyme Description: glucooligosaccharide oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	AXCR01000001|CGC10	50782.93	4.5782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:515858-517297(+)

Full Sequence      

MGHSQSTPSALQTCLNSVCAGRSGCVGYPSDLLYQLEWVKPYNLAVDVSPVAVVRPQNAA
DVAAFVQCAVSNSVSVQAKSGGHSYANFGLGGGSNPGDLAIDLSNLDQFSMDNSTWQATI
GPGATLGDITTQLVDNGNRAFAHGVCPGVGLGGHATVGGLGPMSRMWGSCLDHVVEAEVV
TADGTLVRASATENSDLFWAIRGAASSFGIVTEFVMRTHPAPGSVVQYSFDFSFGSAADL
AAVYSTWQAVIADPNLDRRFGTEFILYPLGAIITGTFYGTADEWTASGIPARLPQTGNKT
IVVNDWLASLTQEAENEALYLSNTQTNFYSKSLGFRREDLLAPAAVVDLFTYVTAANKGT
LLWFIIFDASGGAVADVAQNATAFAHRDKVLFYQSYAIDLLSLSTTTRAFLTNFHTTLLN
LLPGGNGTTVGTYSGYVDPALAAPQAEYYMTNLPELEVLKAKWDPKQVFRNPQSVQPAA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	41	253	4.4e-77	0.44759825327510916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	9.78e-29	50	190	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.44e-26	50	475	32	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215242	PLN02441	8.69e-10	46	233	61	256	cytokinin dehydrogenase
369658	BBE	2.26e-08	432	475	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	2.00e-05	40	241	122	328	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23960.1|AA7	4.93e-189	1	478	1	472
QUC19098.1|AA7	8.22e-180	1	478	1	471
CCA70426.1|AA7	5.55e-157	7	479	50	519
QRD00400.1|AA7	6.39e-152	1	478	1	475
AHG26149.1|AA7	1.02e-150	10	479	5	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	1.66e-68	37	478	45	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	2.71e-67	10	477	2	471	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	6.48e-64	42	479	35	480	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6YJO_A	1.16e-62	4	479	28	505	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
3HSU_A	1.32e-62	42	479	35	480	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	1.52e-99	9	477	5	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	8.52e-68	37	478	45	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	8.62e-67	7	477	21	493	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	3.04e-63	42	479	54	499	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	3.98e-61	29	479	37	492	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000007

TMHMM  Annotations     

There is no transmembrane helices in SPSK_06272-t39_1-p1.