CAZyme Information: SPSK_05994-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_05994-t39_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766		81472.03	4.5172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:821239-823539(+)

Full Sequence      

MVAYKWLALVVAGRLAAAWGTASEDITYVLPIYEGALANDSRTNDLAILSGMKSMLGTGG
RNTKLGFSFSSWCLSRDVSSAAANYTFDPTNLDYVLGLAAELALPILVHANNGRWADCCT
SNSDGGWNDALLDAIAAQPDTTMQNSAGDSLYGHDYGSNYFSFSRYNDYYRSYKRRNLQA
SMRTIAAWAADHPALFAGISLDSETLYANDAADYNPLFVREWKEWMQHTGLYGAGGAYFG
QGRVPAFASVADFNAATGQSFASWDDVAPPAPLRTGDPFTEEWQRWRIQAIVHTTSDETA
WIVEAGIPRDLVYGHQTPELEFYAFADDLTTATAALGAGGYTAYGRAPLDFQSIDTPLRA
DGGNNFGLFELNPLSTDDAFAYDTLTTLWRDGAKILCPNAFENVTAKDQYALFGSPTTGD
TWGNNINKFLATYADTARPQQPPGWNPGRKVFDLYDAFATATASGPDNHLAANGSSGGVA
LKTVYEAVGGVITYTVPLPAVRDGQRLNFYAALGIKDGAGPNGGTATFQAAINGDSLLLG
NGIILPPTYWTWKHWLPVLADVTAWAGQTVSFTLSTTGNDVYGWTQWGSPALYQTPAGAS
GGDTRASNLALHSPVTASSDDRSAPGGGWAVAYLTDGNVRGDAATSNGWSSAAHASSQAT
EWVAVDLGRQQSVGKVVLHPRSDVSTAAGTGFPVAFVIEGSTGSGNAWTTLSSQPSYGAS
IKAGRAEVITFPSATVRYVRVTATELSGVGGETGYRMQLAELEVYA

Enzyme Prediction     

No EC number prediction in SPSK_05994-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	616	762	8.2e-19	0.9596774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395611	F5_F8_type_C	7.59e-11	614	751	1	120	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU78428.1|CBM32|GH39	1.30e-21	557	765	436	645
UKS27947.1|CBM32	9.95e-19	608	765	602	757
SDS02659.1|CBM32	2.31e-18	608	764	206	358
QGQ98682.1|CBM32	2.27e-17	608	764	584	733
SDS02613.1|CBM32	3.93e-16	608	764	203	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RVA_A	8.80e-06	608	765	7	136	Solution structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
4ZZ5_A	8.98e-06	608	765	8	137	X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ5_B X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ8_A X-ray crystal structure of chitosan-binding module 2 in complex with chitotriose derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ8_B X-ray crystal structure of chitosan-binding module 2 in complex with chitotriose derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]

Swiss-Prot Hits     

SPSK_05994-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999747	CS pos: 20-21. Pr: 0.7878

TMHMM  Annotations     

There is no transmembrane helices in SPSK_05994-t39_1-p1.