CAZyme Information: SPSK_05967-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_05967-t39_1-p1
• CAZy Family: GH3
• CAZyme Description: mannosyl-oligosaccharide glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	AXCR01000001|CGC13	92945.85	4.9451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:2814772-2817261(-)

Full Sequence      

MAFMRQLALAVGVAIAGLGHSAAAQTGDESALFSETARLNNDSLLWGPYRPNLYFGVRPR
IPKSLVSGLMWGRADTYTDLQNHVRYTCEQNEGMEGYGWDEYDTRRGGAQTIHDTFNNID
ITTSFVKVPGGAHGGSWGARIKGVPRPKAPTDDHPDASVKTMVVFYLAQEEDGSAIRVAD
VSGRDWDELGFAGDVTFEGASSGLGDYKVVVTKGTGAHPQSDHAYAAERDLEKTVVQSLT
APEEHLWQTKPLLFQRIKEAVDHVIAAYDPNAAPPPWHVYQLGNQPGPGNLQFVQRMYEG
AFEFDILFSSASAGKDLTSDDVTREIRAASESFGAKFNKVFSLQAPFAADTYRAFAHSMF
SNLIGGIGYFYGYGIADRSYAAAYEEEDEGFWEDAAQARAAHRETMDGPYELFTSIPSRP
FFPRGFLWDEGFHLLPIADWDMDLTLDIVKSWFNLMDDDGWIAREQILGSEARSKVPAEF
QIQYPHYANPPTLFFVVDRFVQKLRQAANGTAGHDAAAGSSSNLVDNTELGLEYLRALYP
RLRRQYDWFRRTQFGDIKSYERSAFSKREAYRWRGRTEAHVLTSGLDDYPRPQPPHPGEL
HVDLMAWMGMMTRSLLNIAEVLGTDASTEEAQQLRAIQEAIARNLDDLHWSEDEGCYCDA
TVDDYEENKLVCHRGYISLFPLLVGLLEPTNPKVGRLLDLLGDEDELFSPHGLRSLSKKS
PLYGTAENYWRSPVWININYLALVQLQALGQQAGPFRARAADLYNRLRRNIVDTVYASWK
ETGFAWEQYNPETGKGQRTQHFTGWTSLVVKIMAMPEVDVTTGHVRDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	599	813	1.6e-31	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	317	815	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	5.05e-111	44	275	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	7.24e-09	462	735	304	537	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	3.77e-06	602	807	578	773	alpha-glucosidase; Provisional
224541	TreA	6.66e-06	600	810	352	545	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ERS95155.1|GH63|3.2.1.106	0.0	1	829	1	829
AFP89323.1|GH63	0.0	44	829	1	786
AEO56870.1|GH63	0.0	21	829	30	838
AEO63368.1|GH63	0.0	1	829	13	831
QBZ64685.1|GH63	0.0	1	829	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.76e-173	35	813	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	3.44e-134	44	814	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	3.04e-221	41	814	39	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.21e-173	33	813	34	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.19e-134	44	814	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	4.96e-133	46	814	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.08e-132	44	814	94	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999728	CS pos: 24-25. Pr: 0.9464

TMHMM  Annotations     

There is no transmembrane helices in SPSK_05967-t39_1-p1.