CAZyme Information: SPSK_05958-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_05958-t39_1-p1
• CAZy Family: GH3
• CAZyme Description: alpha-L-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718		77292.37	5.2015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:2668401-2670939(+)

Full Sequence      

MDIFCSGTPAGLCDIRANTSRPTGYRNIAGSLLTRPWIGIIVLVAMTATATASPPVGQQF
LDSNSTSWHKYVRAPGSKIIPPARILPQYTTGNVTNTDGLLQHGSGPTVLTRLGTDDGVP
SFVIDFGINVAGQLSIDFAGAYNTTAGFPGISLAFSETLQYLSNRSDFTRSDNAGGNLKL
TSGTDQVAVKPEPYSWTNQLGCEYGTQVCADGLHGFRYVKIRLTSLPTDSPYTSAYGSVS
ISAINLQYSGYLGTPDTFTGHFECSDPDITQWWYDAVYTNDLCTDSFLSNTTEPRNAASP
SLLGKLVLLDGPKRDRDPYVGDLAVSALTTYLSHNTSEASLNVLEDLARHQRDDGWIPPA
SIVLVKVLDEYYVSNTNTATSLIERPGGTGDFAFLPRTGPVTYYNALYIHALQYAANVAQ
ILNNSEDASRWQIRASAVGQALLKRNYDTSAGAFFDGGPCSNNTICPTHSQDGNSLAILS
GVVPSGLSSDTSIAESILAYMNRTMYKPYGNAFYDNNILDPGGDYVNRVYAFTSYFEIAA
RFETSLKTSQGALEETRRLFGWMAGHDPTVTVWEGIGKDGTPYESGFTSMSHGWSTGIVP
LLVNYVLGVSPAAPGFKKWRVKPVLPAMDNVSWASGLVPTPDGGIWVQWERRRGTFVLLV
SAPDGTEGTVTIALSAGESSSVSVDGTVVYSQKDRKVGDNNGYVSISLQGGRHIIIVH

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	372	671	5.9e-46	0.5238095238095238
GH78	121	359	3.6e-24	0.35912698412698413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	1.17e-12	608	678	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	1.41e-12	259	484	3	239	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT03284.1|GH78	1.02e-265	28	717	1	711
UKZ52996.1|GH78	3.34e-265	68	717	32	695
UKZ64081.1|GH78	4.89e-256	67	717	29	710
UKZ78837.1|GH78	5.61e-256	68	717	32	714
UKZ97108.1|GH78	4.54e-254	67	717	29	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	4.63e-13	215	672	504	941	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

SPSK_05958-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.656428	0.343554

TMHMM  Annotations     

There is no transmembrane helices in SPSK_05958-t39_1-p1.