CAZyme Information: SPSK_05940-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_05940-t39_1-p1
• CAZy Family: GH3
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		89669.33	5.2452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000001:378527-381199(+)

Full Sequence      

MATPHETTLPASSGKRPLDDHTFPGQTPALSRLASLGSHNHVDDGGIDNGSLLRTRDSNA
TAVPGLITDDTYFYGDSPPVYPSPDMTGVGTWAVAYNKAVALVSQMTLAEKVNLTAGVSS
GTGCSGTIPGVPRLNFTGMCLSDAGNGLRSTDFVSAWPSGIHVGASWNRTLARQRAIGMA
GEFKKKGVNVMLGPVVGPAGRTVRGGRYWEGLSVDPYLAGALVYETVTGTQQTGVITSTK
HYIANEQETNRLQSVQSGDVQSVSSNIDDRTMHELYLWPFQDAVLAGSGNIMCSYNRVNN
SYGCANSKTLNGLLKTELGFQGFVVTDWGAQHAGVASALAGLDVTMPNSVLWGDNLVNAV
KNGSVPESRVTDMATRIVAAWYQMGQDTGIPAPGIGMPVDLTRPHPIVDGRDPAAKQTLL
DGAVEGHVLLKNNNHALPLQTPKFLSVFGYSARAADQNNYEGSVSAWEFGAEAANITDIL
AGFVGSPNPHPLGIAPNGTLFSGGGSGANSLTTASAPFDALTQRAGRDGTQLFWDFTEQN
PSVNAVSEACLVFGNVWATESVDRPALSDDYTDQLIANVASKCSNTIVILHNAGVRIVDA
WIDHPNVTTLLFAHLPGQASGEALVSLLYGDANPSGKLPYTVAKQAADYGAVLDPDLPAG
VFGLFPQANFTEGVFVDYRHFDARNITPRYEFGFGLSYTTFAFANLAIQKATPVSGAETN
LFAEYPTGAVRQGGQADLWDQLVTVTADVQNTGRVAGAEVAQLYVTLPGAGEGADGAAIP
VRQLRGFDKRLLAAGATAQVTFALTRRDLSYWDVVAQKWRLPAGTYTVRVGSSSRNLPLT
GTFAIEGGLS

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	131	347	2.7e-56	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.08e-45	102	835	41	755	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.65e-41	428	678	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.36e-40	142	439	66	350	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.46e-33	158	377	89	313	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	4.47e-28	759	834	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76150.1|GH3	0.0	66	845	1	770
CAP73666.1|GH3	0.0	66	845	1	770
CDP26068.1|GH3	0.0	66	845	1	770
UPL04117.1|GH3	0.0	66	845	27	797
UKZ52058.1|GH3	0.0	62	842	16	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	2.99e-184	60	839	10	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
4IIB_A	8.44e-176	77	839	6	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJJ_A	6.53e-172	77	839	7	834	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
6SZ6_A	1.20e-170	74	839	1	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
6JBS_A	2.14e-170	81	843	49	801	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UDK7|BGLM_ASPOR	0.0	67	845	26	768	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	0.0	67	845	29	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	0.0	67	845	26	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|A1D122|BGLM_NEOFI	0.0	67	845	29	769	Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglM PE=3 SV=1
sp|A5ABF5|BGLM_ASPNC	0.0	51	845	9	765	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000004

TMHMM  Annotations     

There is no transmembrane helices in SPSK_05940-t39_1-p1.