CAZyme Information: SPSK_05120-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_05120-t39_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	AXCR01000012|CGC7	57917.38	4.6890

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000012:2328363-2330201(+)

Full Sequence      

MKVSILAAAAALAGGVSANRVHHRHAAAHDLFQKRGHAEGEVCTTIVSTIYGEMTWHPTP
ACSDTTTTKVTKTHAVTTTVTKPETTVTKPTTTVHLETTVTTETPCTVPTIVVQTCPTPG
TYTFPATTVVVTETTTVCGAETTSVPAGTHTLGGVTTVVETETTVVCPVATTSTLPNGIV
TSIIQETTYVCPSAGTYTIGPVTTVCATETVVVIPVVTTFCPGTYTRPAVVTTVTETDVV
VYCPFSIPTTAPAPTTTPAPAPAPVKTTSAAPAPPKSTTSAVAKPPTTHSGLGGSGDQWA
ITYTPYTSSGSCKSSSQVMSDLQEIKAKGFTTIRVYSTDCDTLPNVGAACDATGLKLIIG
VFISEVGCDNGNPDVASQIAAIKAWGKWELVELVVVGNEAGNQGFCTPEQLKELIVEVKE
IIVEAGCSVPVTTTDTVNTWQDTNFSGVLCSVVDVVACNSHAYFNAETVPSQAGAFVAGQ
LEIVKNICGLPGYVMETGWPSQCVANGVATCSESDQASAISSLKAALGSQVVFFSYSNDD
WKDNGSCGCEQHWGCGQLF

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	320	554	1.4e-16	0.9003215434083601

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.31e-56	268	554	16	299	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM43656.1|GH17|3.2.1.-	2.76e-132	1	559	1	533
AEO65848.1|GH17	8.02e-128	101	559	38	481
ACM42427.1|GH17	2.00e-124	1	559	1	532
ACM42426.1|GH17	2.00e-124	1	559	1	532
AEO54157.1|GH17	5.34e-124	1	559	1	553

PDB Hits     

SPSK_05120-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WC60|BTGE_ASPFU	5.80e-81	1	559	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	5.80e-81	1	559	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|B8MXP5|BTGE_ASPFN	6.01e-78	144	559	193	601	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	6.01e-78	144	559	193	601	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|Q0CEX9|BTGE_ASPTN	7.19e-74	1	559	1	558	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000578	0.999392	CS pos: 18-19. Pr: 0.9725

TMHMM  Annotations     

There is no transmembrane helices in SPSK_05120-t39_1-p1.