CAZyme Information: SPSK_04339-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_04339-t39_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		44998.23	5.2303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000009:537404-538651(+)

Full Sequence      

MAAYIPQTVTLDGRELAAIKAHLHDDNKNDSNTALRVALDQLTTEADGWLTQGPWSVVDK
AKAGPSGNLHDYVSQAPYYWPDPARASEGGLPYIQRDGQKNPEVLTYTDRVYVEKVFRAA
YVLALASFYTDNAKYATHAARVLRTWFVAPATAMRPNLDHAQLIPGVNTGRAIGIIDFSQ
AYASVLDAAILLREQSTKGTKGTEGTDDGWTDEDDAGFRDWNRSFLAWLVDGAFGQTEHA
ERSNHGSFAAMLVATIAAYVGDTDQVAQEVAHAVHTHIPATIEADGRQPAELARTRSWHY
STFNLLALTRLAMVADRQDGGERLWPSLFPAVEYVLPAATGGRDKWPHPDLQFEQFAAAD
VVRAAAAAGHAASQAALPLLAMPPDGDMWPLRPAPEQLDPVRAPGQTPGAAKPGQ

Enzyme Prediction     

No EC number prediction in SPSK_04339-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	57	325	6e-86	0.899641577060932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	3.26e-68	56	343	1	272	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ91510.1|PL38	5.57e-143	7	402	13	399
QYT05074.1|PL38	4.30e-132	7	402	13	398
ANJ06002.1|PL38	1.66e-125	6	401	46	431
QLH25273.1|PL38	1.38e-124	5	401	45	431
UKZ57209.1|PL38	2.19e-123	7	388	13	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.14e-39	38	352	29	334	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

SPSK_04339-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000002

TMHMM  Annotations     

There is no transmembrane helices in SPSK_04339-t39_1-p1.