CAZyme Information: SPSK_04131-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_04131-t39_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	AXCR01000010|CGC3	67304.03	5.4666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:4518615-4520459(+)

Full Sequence      

MVRFGRVVGVAAAAAAAVAPVSARPSSDDSHDSHDSLDSNSRQSKRDGADTVGCPDYTSY
ATSRDHQPFSGGRFNLPYQRPPPECRRFKVPEVEDTIDAMRKLVRDPDLFRLFENCFPNT
LDTAIAWHGVGADTTDEELTFVTTGDINAMWLRDSANQLQSYRSLLRPKGKKGKKDTKDD
EGLSTLASLFRGTINLQARYIQNSPHCNAFRPPVESGLTVTGGFGGGDIVYPPVAHDVVF
ECKYELDSLAAFLQLSYDYYAATDDGAFFGKVYRKDGDGGDDGNDGDDSEFRSTWVLAVE
ATMATAEEMTKGTYGPDGRPQVSPYQFQRPTSVATETLPNGGAGPPVQGGTGMVRSAFRP
SDDACTHQLFVPANMMLARYLAACAPIMAQLGRGRAPAKTDSLRESPLVDAAAVADDDYS
NYRQGHRSRYFHELALRMTNFAATIRVGIERYGRVAHPVYGDVYAYEVDGFGSHNLMDDA
NIPSLLSAPLLGYVDRHDPVYRNTRRLVLSRANPYYMTGPVLNGTGGPHVGTGMAWPMSL
VVQIMTTDDDYEIAAALRQLVSSTDGLGLMHESVSSHDESAWTRQWFSWANGLFGQMLLD
LRDRKPHLLATSFQ

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	286	599	7.7e-105	0.6666666666666666
GH125	106	274	3.3e-48	0.35572139303482586

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	106	599	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.63e-146	85	609	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62552.1|GH125	1.52e-209	54	613	67	577
UQC90852.1|GH125	4.17e-205	54	614	62	552
UPK90974.1|GH125	1.02e-198	49	614	14	512
CBX94219.1|GH125	1.95e-194	51	614	62	557
QSZ30983.1|GH125	2.89e-194	54	614	28	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	2.91e-84	48	614	15	481	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	3.43e-81	80	614	21	463	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	8.97e-81	75	614	18	461	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QPF_A	4.19e-64	93	603	8	424	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
6RQK_A	3.88e-63	104	600	23	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.31e-133	54	612	27	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.430658	0.569341	CS pos: 23-24. Pr: 0.5291

TMHMM  Annotations     

There is no transmembrane helices in SPSK_04131-t39_1-p1.