CAZyme Information: SPSK_04118-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_04118-t39_1-p1
• CAZy Family: GH16
• CAZyme Description: endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	AXCR01000010|CGC3	65075.99	5.4140

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:5492339-5494213(-)

Full Sequence      

MVFLKVATPAVAVAVSLFSLPSASASLTAGNCTAPFVPITATEFVQNLNPGWNLGNTLDA
VPDEGSWNNPKVTPDVFATVKASGFRSVRIPVTYADHFVSGSPAWTINSTWLARVAEVVQ
MATDAGLYVVTNMHHDSWRWADVTKEGANQTEIAEKFAAAWRQIARTLACAPSSVALEPI
NEPPANTAEDGQRLNHLNQLFLAALTDGHNPQRVVTLVGGGEDAEKSSLWFERPANTTTN
PWTIQFHYYSPCKPMTWTNKAREDGGRRTSGANSFIFGAWGKTIWGSEDDKAAVVSDLTA
IHNNFTDLHLVLGEFDASPTNVEASARWRYTDFLVRTARSLNISVMYWDNGIDNLDRAAE
QWRDPTSADLVVSAATAKPGVVNSLPAGTTNDTGAAATTQATSAYVFQRVGAPITDQALP
YLFNGNNVTAIRDGSAALAAGNDYAVNSTHILLSASYLAKHFAPTAPAGIRANLTIVFSG
GAVAMPLQLVLWDVPVLASTTSVASLNTSADDDLAIPVAYKGLPLVAAVRLTSLNGTGLV
DTWTQYLGPLQQQRATYNSHWKFDEGHVIITADALKTVVATREPAVFTFEFYPRTPGNAV
NYTLTV

Enzyme Prediction     

EC	3.2.1.-:12	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	64	351	1.9e-58	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.57e-24	64	354	16	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.14e-16	50	351	53	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
397483	CBM_X2	7.83e-16	405	482	6	77	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFG25592.1|CBM1|GH5_4|3.2.1.4	9.41e-210	32	606	106	655
AIO06743.1|CBM1|GH5_4	9.41e-210	32	606	106	655
CAP96338.1|GH5_4	2.54e-207	22	606	16	574
QQK43655.1|GH5_4	4.66e-202	32	606	44	592
EAA59690.1|GH5_4	6.19e-200	32	606	23	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YZP_A	4.48e-83	39	605	22	535	Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
5E0C_A	1.95e-45	43	605	12	527	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5XRC_A	3.97e-45	43	605	45	560	A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
4V2X_A	9.44e-43	43	604	60	574	Chain A, Endo-beta-1,4-glucanase (cellulase B) [Halalkalibacterium halodurans]
5E09_A	1.47e-42	43	605	12	527	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23550|GUNB_PAELA	7.13e-52	38	604	34	554	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
sp|O08342|GUNA_PAEBA	7.70e-37	17	353	16	371	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
sp|P10477|CELE_ACET2	8.83e-36	39	379	55	389	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
sp|P28621|GUNB_CLOC7	2.30e-34	39	351	40	341	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
sp|P28623|GUND_CLOC7	1.85e-32	39	351	41	339	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999735	CS pos: 25-26. Pr: 0.9713

TMHMM  Annotations     

There is no transmembrane helices in SPSK_04118-t39_1-p1.