CAZyme Information: SPSK_03994-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_03994-t39_1-p1
• CAZy Family: GH16
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		92729.57	5.8660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:5436770-5439382(+)

Full Sequence      

MKPSQLDVEAVLEQLSLDEKVALLAGIDGWHTKAIPRLGVPSVRMSDGPNGVRGTRFFNG
VPAACLPCETALGATFDQALVRELGALLADECRAKGAHVLLGPTINIQRGPLGGRGFESF
SEDPVLSGTLAARYCEGVEAGGDVLATPKHLVCNDQEHARVAVNAIVTERALREIYLLPF
QLALGQARPGALMTSYNKLNGTHASENPRLLQDIVRREWGYDGLIVSDWFGTYSVSEAVN
AGLDLEMPGMSGFRGPALIHAVTSNKVKETTIDERVRRVLQMASKALASSIPEMLAPEQT
RDTPATRALLRRAAAESVVLLKNEDGVLPLNPAKRTLVLGPNANTATYCGGGSAALPAYY
TTTPLQGIRSKAASPDLVAFTQGAYGHKELPLLGEHLTTGDGRVGYTFRVYTESREQNPQ
RQAVDELHMTSSSAFLMDYMHPQVKGDTYYVTMDGTFTPVETGLYDFGLTVAGTGLLYID
GQLVVDNKTNQRQGTSFFGIGTPEERGSIELTAGRAYAVHVDYGTAPTSSLKVKNVVSFG
PGGLRLGGAKRIDPAKGIAEAVALAADTHQFDQVVVCVGLNSDWESEGFDRPHMDLPAGS
DELVQRVLAARPDAVVVVQSGTPVTMNAWASSAKGLLQAWYGGNEAGNGIADVLFGNVNP
AAKLPLSFPATLQQNPSYLNYRSEGGRVLYGEDVYVGYRYYDATGVQPLFRFGHGLSYTS
FTSSDLTAAVSASDAAIQASSIRLSLSVTNTGDRAGAEVLQVFVAPPATTSIRRPPRELK
AFHKVPSLAPGETRAVTLDPVSLALATSFWDENRDAWLSEAGEYTLHVVGTGSDNTVSTT
FSVAKSRWWTGLLGKIDAAPNGTSGVNGHA

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	248	3e-64	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.65e-68	30	373	50	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.46e-66	67	841	121	762	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	4.34e-52	318	698	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.27e-38	10	800	55	744	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.40e-37	37	280	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58910.1|GH3	0.0	28	852	55	850
AJA36818.1|GH3	0.0	5	852	3	838
BAE61980.1|GH3	0.0	5	852	3	839
QMW44618.1|GH3	0.0	5	852	3	839
QMW32588.1|GH3	0.0	5	852	3	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.37e-240	4	852	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.51e-235	4	852	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.26e-134	7	837	4	661	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.57e-108	12	833	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	7.02e-99	11	843	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WLY1|BGLJ_ASPFU	0.0	8	852	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	0.0	8	852	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	0.0	5	852	3	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	5	852	3	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	5	852	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000005

TMHMM  Annotations     

There is no transmembrane helices in SPSK_03994-t39_1-p1.