CAZyme Information: SPSK_03419-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_03419-t39_1-p1
• CAZy Family: GH130
• CAZyme Description: glycoside hydrolase, family 16

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42726.46	4.1471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:1487571-1488811(-)

Full Sequence      

MTMALRRRFSFPSFTGSAWSISAVVGGILLFGFACPAAADCECGYSTVIDGDVQAFTDLI
ETDFAHLDNISTNTDWVRQAFNVTSEKDRGSYGEMYAIENMRTQPDPNGQVEDGQAKNGQ
PAGLDLTVKANIVAGMVPVSEIDTNRTDILYGSFRAGMKLTNVSGTCSAFFWYFNDTQEI
DMEFLSKEYNASNNTYPVNLVLQSREAAEDGFDAQGTPTFLKVNLPFDPTADFHEYRIDF
LPGSVYFYADSELLAEMDSDAVPTHAGHLVLQQWSNGNPLWSAGPPTEDAVTTVSYVKAY
FNSSLPQRQQDWSLRCRDPSAPGAVCTIPDSTATNTTPAGWFFTSQNNMTNNQTVSGQKN
SGRITTAATVLWPVFAIVFAIVGWELNIW

Enzyme Prediction     

No EC number prediction in SPSK_03419-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	114	300	4.5e-89	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.95e-41	104	300	20	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.38e-10	151	296	68	205	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	3.71e-08	140	253	23	124	Glycosyl hydrolases family 16.
185685	GH16_XET	6.77e-07	150	251	47	141	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
178706	PLN03161	2.17e-05	150	251	68	161	Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62950.1|GH16_23	7.41e-134	14	381	21	386
AEO58087.1|GH16_23	2.90e-129	37	369	55	406
VBB86764.1|GH16_23	7.12e-129	37	378	41	390
CDP32289.1|GH16_23	1.01e-128	37	378	41	390
UQC77992.1|GH16_23	3.40e-126	39	362	21	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O5S_A	1.01e-06	151	275	96	209	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1GBG_A	1.46e-06	151	275	72	185	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P04957|GUB_BACSU	5.40e-06	151	275	100	213	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2
sp|P07980|GUB_BACAM	9.49e-06	151	275	97	210	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1
sp|P27051|GUB_BACLI	9.81e-06	151	275	101	214	Beta-glucanase OS=Bacillus licheniformis OX=1402 GN=bg1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.047665	0.952305	CS pos: 39-40. Pr: 0.8790

TMHMM  Annotations     

Start	End
13	35
364	386