CAZyme Information: SPSK_03408-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_03408-t39_1-p1
• CAZy Family: GH13
• CAZyme Description: sialidase-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	AXCR01000010|CGC23	43650.15	4.8923

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:201478-202740(-)

Full Sequence      

MRSSLLSGFGLAVLTAAAPAHRSSDLITNTTLATAGSGPFNYYRIVSLQSLGNGVVLAAF
DGRPTGADAPAPNSILQRRSTDYGATWGSMTYIAEGQAANAGTGVLAYGFSDPSYVYDSA
TSTLFNFHVFSKDASFASSVLGNNDTSRNIVSAEVSVSTDGGLSWSTDPTNQPNLPPVAS
SQVGVPPLLTSAVKPNGSPVGSVSDVGAVLGEFAASGQGIQLQYGAHAGRLIQQYLGRVV
QPSGSVVYQAYSVYSDDHGATWQMGTPTGTGMDENKVVELSNGTVMLNSRPSDGSGYRKV
ALSNDGGLTYTTPRTETQLPDPACNGQISRLYPNAAENSAQAKILLFTNANSKTSRANGT
ARFSCDDGNTWSSGIAYSPGATSYSTITPLGDGTVGLFYEGLNNQLIYLRVDTAWLGINC

Enzyme Prediction     

EC	3.2.1.18:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	28	404	2.7e-76	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.95e-81	30	400	1	323	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
226840	NanH	8.29e-29	28	400	260	643	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
404074	BNR_2	9.38e-10	237	397	122	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
404074	BNR_2	5.36e-04	249	372	81	199	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23515.1|GH33	3.78e-197	11	420	19	423
CAT16707.1|GH33|3.2.1.18	1.44e-171	4	420	13	407
CAX30683.1|GH33|3.2.1.18	1.44e-171	4	420	13	407
CAP97302.1|GH33|3.2.1.18	1.44e-171	4	420	13	407
BCT74701.1|GH33	3.79e-155	18	420	48	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	2.76e-109	26	420	8	363	Sialidase [Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	3.57e-106	26	420	8	363	Sialidase, Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	1.27e-105	26	420	4	359	Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	2.52e-105	26	420	4	359	Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]
1W8N_A	3.56e-105	26	420	4	359	Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q02834|NANH_MICVI	2.81e-105	1	420	24	405	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
sp|P29767|NANH_CLOSE	3.07e-15	34	416	386	826	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
sp|P15698|NANH_PAESO	2.45e-09	30	310	39	282	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
sp|P10481|NANH_CLOPF	1.69e-08	42	310	35	264	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
sp|A5F7A4|NANH_VIBC3	3.71e-08	237	416	566	772	Sialidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=nanH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999618	CS pos: 22-23. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in SPSK_03408-t39_1-p1.