CAZyme Information: SPSK_03378-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_03378-t39_1-p1
• CAZy Family: GH128
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		37331.89	5.6208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:117115-118468(-)

Full Sequence      

MLFALTTALALAGAASALPQGRATSGVQFVGTNIAGFDFGCSITGVDNITQAYPPLSSLG
GPDGAGQMQHFVKDDGMNIFRLPVGWQYLLNNNLGGKLDGNNAGKYDQLVQACLATGAYC
IVDIHNYARWNNQIIGQGGPTNEQFADLWSQLATKYASQQKIVFGIMNEPHDVPDINKWA
DSVQAAVTAIRAVATKQMILLPGNDWTSAEQMSTKSGPALLKVKNPDGSVDGLIFDVHKY
LDSDNSGTHTECVTDNISKAFQPLATWLRANKRQALNSETGGGNTASCQKYLCSQIQFLN
QNADVFLGYVGWSAGSFSPATYELSEVPTKNGNSWTDSSLVTACIARKS

Enzyme Prediction     

EC	3.2.1.4:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	319	1.5e-99	0.9858156028368794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.67e-72	33	318	2	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	5.23e-19	71	319	81	364	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS45836.1|GH5_5	2.22e-201	5	349	5	356
AEO67179.1|GH5_5	1.09e-195	9	347	9	349
AEO69910.1|CBM1|GH5_5	8.59e-164	28	347	92	416
ADZ44606.1|CBM1|GH5_5|3.2.1.4	5.93e-162	28	349	81	407
AUS45833.1|CBM1|GH5_5	1.63e-160	14	349	81	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QR3_A	7.04e-160	26	348	2	328	Chain A, Endoglucanase EG-II [Trichoderma reesei],3QR3_B Chain B, Endoglucanase EG-II [Trichoderma reesei]
5D8W_A	2.67e-154	27	346	22	342	Structrue of a lucidum protein [Ganoderma lucidum],5D8W_B Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_A Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_B Structrue of a lucidum protein [Ganoderma lucidum]
5HOS_A	6.81e-49	18	332	15	324	Crystal structure of the endo-beta-1,4-glucanase Xac0029 from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
4W7U_A	8.01e-48	22	333	17	320	Crystal structure of XacCel5A in the native form [Xanthomonas citri pv. citri str. 306],4W7V_A Crystal structure of XacCel5A in complex with cellobiose [Xanthomonas citri pv. citri str. 306],4W7W_A High-resolution structure of XacCel5A in complex with cellopentaose [Xanthomonas citri pv. citri str. 306]
5HPC_A	9.07e-48	22	333	17	320	Structure of XacCel5A crystallized in the space group P41212 [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A024SH20|GUN2_HYPJR	4.79e-159	24	348	90	418	Endoglucanase EG-II OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=egl2 PE=1 SV=1
sp|P07982|GUN2_HYPJE	9.65e-159	24	348	90	418	Endoglucanase EG-II OS=Hypocrea jecorina OX=51453 GN=egl2 PE=1 SV=1
sp|Q66NB7|EG5A_PHACH	6.65e-93	31	337	80	379	Manganese dependent endoglucanase Eg5A OS=Phanerodontia chrysosporium OX=2822231 GN=Eg5A PE=1 SV=2
sp|Q04469|GUN1_SAIFL	1.28e-84	31	329	37	324	Endoglucanase 1 OS=Saitozyma flava OX=5416 GN=CMC1 PE=2 SV=1
sp|P58599|GUN_RALSO	1.22e-46	12	329	100	408	Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=egl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999773	CS pos: 22-23. Pr: 0.8737

TMHMM  Annotations     

There is no transmembrane helices in SPSK_03378-t39_1-p1.