CAZyme Information: SPSK_03206-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_03206-t39_1-p1
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	AXCR01000010|CGC25	66516.93	5.4984

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:492372-494234(+)

Full Sequence      

MPSFRALAAAVLLLVPGCVRGAAVNSNPGNSHAHGGGHGGGKGGGQRNGNVTHCGTDFCT
WWHTTGEINTWTPVKPGNVRQSHRYSVEVSPAGANTFYDSFVYEAIPRNGNGRIYAPTDA
PYSNTLSATVDDGISIEPSIGLNMAWSQFEYSHDVDVRITTIDGSTLGGAGSVTIRPTAD
NLAMRDGGDGSVIIRVPAATNGYRFSVEFANDLYSFRSNGSDYVTSGGSVVGVEPTNALV
IFASPFLAASDVPSMTAANTHTMTPGPINNGDWGNKSILYFPPGVYYMNQDQSGNVGKLG
SNHMRLGSNTYWVHFAPGAYVKGAIEYFTTAAQFYATGHGVLSGENYVYQANAAEDYVAV
KSDTTSLRMWWHNNLVRGQTWTCQGPTIAAPPFNTMDFNGNSDVSSRISNYKQVGAFFFQ
TDGPEIYANSIVHDVFWHVNDDALKIYYSGASVSRATIWKGHNDPVIQMGWTVRSISGVT
IDTLNVIHARYSKSETVVPSAIIGASPFYEDGMTVSPNESISMSVSNIVCEGLCPALMRI
TPLQSYTNFKVTNVSFPDGLQTNSIGIGESLIPAASGVTMDLIISNWTVNGTKVTMSNFG
SADLGQFNIDASYWGEWEIV

Enzyme Prediction     

EC	3.2.1.11:4	3.2.1.57:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH49	51	618	3.3e-252	0.9963570127504554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407501	Glyco_hydro_49N	8.05e-83	51	246	2	186	Glycosyl hydrolase family 49 N-terminal Ig-like domain. Family of dextranase (EC 3.2.1.11) and isopullulanase (EC 3.2.1.57). Dextranase hydrolyzes alpha-1,6-glycosidic bonds in dextran polymers. This domain corresponds to the N-terminal Ig-like fold.
397674	Glyco_hydro_49	1.38e-30	512	619	3	117	Glycosyl hydrolase family 49. Family of dextranase (EC 3.2.1.11) and isopullulanase (EC 3.2.1.57). Dextranase hydrolyzes alpha-1,6-glycosidic bonds in dextran polymers. This domain corresponds to the C-terminal pectate lyase like domain.
408611	B_solenoid_dext	6.53e-13	392	423	1	33	Beta solenoid repeat from Dextranase. The crystal structures of Dex49A from Penicillium minioluteum and of ATCC9642 isopullulanase from Aspergillus niger include beta-solenoid repeats, sharing structural similarities. This Pfam entry includes a single repeat unit of the repeat regions.
408554	IPU_b_solenoid	2.47e-09	459	491	1	33	Isopullulanase beta-solenoid repeat. IPU and dextranase repeat unit includes three (or one long and one short) parallel beta-strands. The repeat region as a whole folds into a beta-helix, known as beta-solenoid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACC95417.1|GH49|3.2.1.11	0.0	1	619	1	607
QGA21309.1|GH49	0.0	50	619	37	605
AAB47720.1|GH49|3.2.1.11	0.0	23	619	21	607
AZC11123.1|GH49	0.0	1	619	1	607
AHJ14526.1|GH49	0.0	50	619	39	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1OGM_X	0.0	52	619	7	573	Dex49A from Penicillium minioluteum [Talaromyces minioluteus],1OGO_X Dex49A from Penicillium minioluteum complex with isomaltose [Talaromyces minioluteus]
1WMR_A	2.89e-114	51	615	6	543	Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],1WMR_B Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],1X0C_A Improved Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],1X0C_B Improved Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642 [Aspergillus niger],2Z8G_A Aspergillus niger ATCC9642 isopullulanase complexed with isopanose [Aspergillus niger],2Z8G_B Aspergillus niger ATCC9642 isopullulanase complexed with isopanose [Aspergillus niger]
3WWG_A	2.89e-114	51	615	6	543	Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger],3WWG_B Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger],3WWG_C Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger],3WWG_D Crystal structure of the N-glycan-deficient variant N448A of isopullulanase complexed with isopanose [Aspergillus niger]
6NZS_A	2.15e-89	60	614	12	579	Dextranase AoDex KQ11 [Pseudarthrobacter oxydans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48845|DEXT_TALMI	0.0	23	619	21	607	Dextranase OS=Talaromyces minioluteus OX=28574 GN=DEX PE=1 SV=1
sp|O00105|IPUA_ASPNG	2.31e-113	51	615	21	558	Isopullulanase OS=Aspergillus niger OX=5061 GN=ipuA PE=1 SV=1
sp|P70744|DEXT_ARTGO	2.86e-94	8	617	16	633	Dextranase OS=Arthrobacter globiformis OX=1665 PE=3 SV=1
sp|P39652|DEXT_ARTSD	1.86e-90	60	614	63	630	Dextranase OS=Arthrobacter sp. (strain CB-8) OX=74565 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999712	CS pos: 21-22. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in SPSK_03206-t39_1-p1.