CAZyme Information: SPSK_03113-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_03113-t39_1-p1
• CAZy Family: GH105
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710	AXCR01000010|CGC35	78241.11	6.6444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000010:2093986-2096255(+)

Full Sequence      

MAAAGLVPRGVVSSALRTTTALVVGALLFSGQPASALFNNGTVIAPCNSTLYCYGEILKG
IELAAPFSDSKTFVDMPTVRPLDEVVAAFNNLTKPLSNNTELNDYLGTYFAPAGGELESV
PTDELTTNATFLHKINDTVINQFVQKVINIWPDLTRQYTGKTGNTSCAGCQSSFVPVNRT
FVVAGGRFREPYYWDSYWIVEGLLRTGGSFVNITLNTIENFLDFVDLYGFVPNGARVYYL
NRSQPPLLSQMIRIYIEHTNDTSILKRAVPLLIKEHEFWTTNRSVSVTAPNNKTYTLNRY
SVLNNQPRPESYLEDYVSANNKSYYAANGSVYPETTPLNSSQKAALYAQLASGAESGWDY
GTRWLARPNDSATDTYFPLRSLNINNMLPVDLNSILYWNEVTIGGFLQTMGNKTGAAQWA
AAARIRSEGMFQLMWNDTLFSYFDYNMSSKAQNIYVPRDNTTTLLAEETAPSGYQVLFDI
AQLYPFWTGAAPAQLKNNPLAVKLAFKRVKAFLDSTEGGIPATNLMTGQQWDQPNVWPPL
QHVLMKGLLNTPATFGVHDTNYQDVRDLALRLGQRYLDSAFCTWYATGGSTSLTPQLMGF
SSADNGTMFEKYTYNSTNGAGGGGEYTVVEGFGWTNGVLLWTADTFGNKLVRPNCGNITA
ANITPGKRKRAVNDVSAGGGLSRRSRPPSAVQLDPYDAAWIKMFGSRTQE

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	67	644	7.4e-153	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.21e-127	67	647	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.80e-123	65	644	25	549	alpha,alpha-trehalase
224541	TreA	4.18e-78	52	652	56	558	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	5.15e-72	1	647	1	537	alpha,alpha-trehalase TreA.
237326	treA	1.39e-68	10	640	10	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70020.1|GH37	0.0	34	705	19	677
AEO53147.1|GH37	0.0	26	705	10	676
AAN38003.1|GH37	0.0	17	707	6	679
QBZ56021.1|GH37	0.0	17	707	6	679
EAA35900.1|GH37	0.0	34	707	20	676

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	4.20e-70	69	647	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	5.82e-69	69	647	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	3.17e-61	55	664	15	518	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	1.00e-58	55	644	52	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	1.08e-58	55	664	15	518	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	7.60e-115	47	655	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	5.31e-100	46	650	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	3.73e-98	46	665	27	574	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	6.41e-98	46	650	27	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	1.23e-95	47	648	45	573	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999703	CS pos: 36-37. Pr: 0.9681

TMHMM  Annotations     

There is no transmembrane helices in SPSK_03113-t39_1-p1.