CAZyme Information: SPSK_02678-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_02678-t39_1-p1
• CAZy Family: CE5
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		31701.43	7.5003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000006:1474249-1475154(-)

Full Sequence      

MHTTLVLGLVSTLAAVASGQGISKVNDFNAGPTKLGMYVYVPKTLAKPAPILVAIHHCQG
SAQGYSTETHYQPLADKHGFVIIYPNSKSGGGCFDVASTASLTHDGGGDSQTVANMVKYA
IQKYGGDANRTFVTGSSSGAMMTNVMVGAYPDVFQAGSVYSGVPDGCFFVQGSTATQDPP
GWANACANGQLTKTAAQWGDLTRSYYKGYTGPRPRMQIWHGTADNTLHYPNYQETLKQWS
NVLGLSDPKTAANTPQSGYTQTIYGAGTSTTAQLVGYSGQGVGHTVPVHESMDIAFFGLD
K

Enzyme Prediction     

No EC number prediction in SPSK_02678-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	35	237	5.3e-25	0.7929515418502202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.32e-39	37	254	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	5.09e-21	4	287	12	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.11e-16	40	167	6	135	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	2.45e-09	46	163	391	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	4.25e-07	72	237	8	165	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF75082.1|CE1	4.94e-176	6	299	3	296
CCA74360.1|CBM1|CE1	1.86e-113	1	299	1	287
CCA73570.1|CBM1|CE1	7.12e-103	4	299	3	287
CCA69795.1|CE1	1.75e-101	9	299	9	287
UQU62194.1|CBM2|CE1	2.81e-99	14	301	26	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.28e-93	22	299	4	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92194|AXE1_ASPAW	5.23e-94	3	299	12	303	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2
sp|A2QZI3|AXE1_ASPNC	2.89e-93	1	299	9	302	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|Q96W96|AXE1_ASPFI	1.16e-92	1	299	9	302	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|Q4WBW4|AXE1_ASPFU	1.00e-91	13	299	16	304	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	5.91e-90	16	299	29	304	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999786	CS pos: 19-20. Pr: 0.9666

TMHMM  Annotations     

There is no transmembrane helices in SPSK_02678-t39_1-p1.