CAZyme Information: SPSK_02518-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_02518-t39_1-p1
• CAZy Family: CE16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		52038.47	6.1969

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000006:593035-594402(-)

Full Sequence      

MSSTLLGGDLLSSVAIRKNGRTARISSFDQTGLNEDAFVVLPGETATLANIEGPGKITHL
WFVQTCRRILGPGLIPYSKSGVAMMEIHNALGLSYEDSDPDYYRKVIIKMYWDDSETPNV
IAPIGDFFCLGHSMAANFQSLPFTVSVKPSEEKKYGGSAAFNCYLTMPFNKRARIEIENQ
GEHAYFQYFYIDYELLPQPFDPKEILYFHAHWRRENPTNGWAPNEMQTNSLETQVPNLTG
EGYTILETTGSGTYIGCNHSVLHHQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFSQGW
GMQKNAYPFCGTIIHEEDVPNHQVSYRWHLADPVRFDKKIKVQLEHGHANHLRDDWSTTA
YWYQTLPGPKLTIQPLDERLPNRPTIKPAPEPAEARPLTDLQKQNIQKREERFKVFVDDR
NAWLERRAKASRERAVNNIEIAKNLKKRYDESLKN

Enzyme Prediction     

No EC number prediction in SPSK_02518-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	103	364	1.1e-79	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	1.07e-109	104	364	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68463.1|GH172	3.52e-308	4	453	7	456
QKD59092.1|GH172	3.46e-270	3	454	6	458
QKX59927.1|GH172	5.26e-266	5	453	4	455
UPK94269.1|GH172	2.30e-265	3	454	4	457
CAP93243.1|GH172	2.04e-263	6	453	3	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	1.14e-151	18	450	15	447	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	6.46e-51	16	364	15	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

SPSK_02518-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000003

TMHMM  Annotations     

There is no transmembrane helices in SPSK_02518-t39_1-p1.