CAZyme Information: SPSK_02495-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_02495-t39_1-p1
• CAZy Family: GT69
• CAZyme Description: glucosyll transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	AXCR01000006|CGC4	49772.05	5.2252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000006:635324-636737(+)

Full Sequence      

MLYPTSLIRSRRSRVALVVAAGWLVWLWHYHRTSAAAAASDHDPSTLAAEFPLAWKHIHM
FNGTGGAWYIPEAWTTDIDGRYQQPHTILEAATYATAAASGSLARRMDFAQIPLIVHQTW
MTASIDGWTPMVVRCVERWLTYAVGQTPAVDEGGPSDNQDGPPMAYFFWDDAGVDTFMRT
YEPDFVDAFYAFFSPVERADIFRVLVCKWFGGIYGDVDTEPLRHPAKWIQQADLAAWTDP
ETGATFGHNTTVQAADRESESESDRDNAVDEDRPVTLLVGLEADVDPASDAYWRMGYTYP
VQLTQWALASAPQHAALAHFIDLVRALAAGGPNPVGTTVVDDPLLWTGPPAITAAISAWL
QEHCGLRWNAVTGLHDNGKAKLVSDVLVLPITGFSPGRGRYGNMGSKPVSDADARLFHHA
QGSWRKFDVKDQLGKLCRTLFGLCRPESIPL

Enzyme Prediction     

No EC number prediction in SPSK_02495-t39_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.97e-14	110	233	80	182	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.53e-06	166	231	20	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI15447.1|GT32	1.08e-148	7	448	2	418
UKZ97010.1|GT32	1.94e-148	1	448	1	419
QYT03156.1|GT32	4.59e-145	1	445	1	421
AEO64619.1|GT32	7.63e-143	4	448	4	436
UKZ53117.1|GT32	1.60e-142	1	445	1	417

PDB Hits     

SPSK_02495-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.25e-20	195	425	208	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	8.44e-13	183	425	156	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q10323|IMT3_SCHPO	9.86e-09	110	253	55	183	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	3.35e-08	112	218	62	147	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	1.97e-07	183	395	183	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.737602	0.262403

TMHMM  Annotations     

Start	End
13	30