CAZyme Information: SPSK_02438-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_02438-t39_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		58109.37	5.2589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000006:1966303-1967910(-)

Full Sequence      

MTRRSKIAAAGVLAGLWTAGTAVGQSCPDYSTYAMNAHAPLSNGSYQLGYMRPDPACRTF
NLTEVESTITSMARSISDPDLYRLFVNAFPNTLDTAIRWKGVAADNADEELTFVITGDID
AMWLRDSSNQMQSYRSLLKASSDPNSLASLYRGVINLQARYLLESPYCNSFQPPVESGIA
PATNGAAKDDTVTPPYDSTKVFECKYELDSLAAFLEVSSDYFTATGDTAFFGKFKWLQAL
QAVLQTATSMMTPTYGDNGTVLTSPYTFTRMTTRSTETLANNGLGSPVAANTGLIRSAFR
PSDDSTLLQLFIPANMMFSHYLEQTAKIVDKLGSAAPKGLGSQMHSLASSLRNAILRHGI
VADTRAGVAGAPVYAYEVDGYGSSIIMDDANIPSLLSAPFFGFTSISDPVYQSTRAAILS
ETPRPGPSQYNSNPYFMHGPVISGVGGPHQGPGYAWPMASIVRILTSDDDDEIVDQLHTL
VSSTSGLGLIHESVNTFDQSKWTRQWFSWANGLFGQMMLDLKERKPSLLKRSYQP

Enzyme Prediction     

No EC number prediction in SPSK_02438-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	78	519	1e-156	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	78	519	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.19e-145	56	532	1	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX94219.1|GH125	5.62e-233	27	534	65	557
QBZ57723.1|GH125	2.29e-231	2	534	40	563
QRC91719.1|GH125	4.44e-231	23	534	17	513
EAA30843.1|GH125	1.87e-228	27	534	38	555
QSZ30983.1|GH125	4.72e-227	27	534	28	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	6.79e-81	52	529	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	2.70e-80	52	529	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.31e-75	52	529	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	6.05e-69	72	520	19	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	7.47e-69	72	520	19	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	6.00e-142	25	532	25	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000447	0.999532	CS pos: 24-25. Pr: 0.9652

TMHMM  Annotations     

There is no transmembrane helices in SPSK_02438-t39_1-p1.